Align The Maltose group translocator, MalT of 470 aas and 10 TMSs. Takes up extracellular maltose, releasing maltose-phosphate into the cytoplasm (characterized)
to candidate BWI76_RS27535 BWI76_RS27535 PTS transporter subunit IIBC
Query= TCDB::Q63GK8 (545 letters) >FitnessBrowser__Koxy:BWI76_RS27535 Length = 519 Score = 217 bits (552), Expect = 1e-60 Identities = 164/548 (29%), Positives = 273/548 (49%), Gaps = 58/548 (10%) Query: 10 QKFGKALLVVVAVMPAAGLMISIGKLIGMSA--GDINAVHTIARVMEDIGWAIITNLHIL 67 QKF +A++ V +P GL++++ ++ + + +H + +++ D W + NL +L Sbjct: 13 QKFSRAMIGAVLFLPVIGLILALSSVLTNPTLISETSFLHQLGQLLGDTFWPLFGNLGLL 72 Query: 68 FAVAIGGSWAKDRAGG-AFAALLAFVLTNRITGAIFGVNAEMLADSKAKVSSVLAGDLIV 126 F V I AKD+ A +++ F++ G N L + + Sbjct: 73 FCVGISYGLAKDKKTEVALVSVMCFIM-------FLGANHSWLEHTHGLAEKING----- 120 Query: 127 KDYF----TSVLGAPALNMGVFVGIITGFLGATLYNKYYNYNKLPQALAFFNGKRFVPFV 182 +Y+ T +LG ++MGVF+GII G A ++NK +LP AL+ + G + Sbjct: 121 -EYYGTGQTQLLGFVVVDMGVFLGIILGCTIAWVHNKVSTI-ELPGALSMYGGAKLTLVA 178 Query: 183 VIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPIVAPFVYGTLERLLLPFGLHHM 242 + AI + WPF+ G+ + +A + FVYG E+ L+P GLHH Sbjct: 179 MTPVVIFYAIAFTWFWPFMTHGIAA----LTGFMKNAGVAGVFVYGFFEKFLIPTGLHHF 234 Query: 243 LTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWIT--DLNNLLANGDTKAYNDLLNN 300 + P T++GGT ++ GQVV+G ++LA++ DL T N+ L Sbjct: 235 VWSPFQLTQIGGTLSV-----DGQVVSGTQAIFLAYMRHPDL--------TPVMNEAL-- 279 Query: 301 VVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPMFLSAALAVFLTGVTEPIEFM 360 RF Q + + L G + A + EK+ K + L A + LTG+TEPIEF Sbjct: 280 ----RFSQ-QGMTTIFGLAGASLAFYHTAKPEKKMMAKAILLPAIITSMLTGITEPIEFT 334 Query: 361 FMFIAPVLYVVYAITTGLAFALADLINLRV-HAFGFIE-LITRTPMMVNAGLTRDLINFV 418 F+F++P+L+V++A T + A+ D+ +R A G IE LI P+ V+ LTR +V Sbjct: 335 FLFVSPLLWVIHATLTAASQAICDIFTVRPWGASGLIEFLIYNLPLPVS--LTR-WPGYV 391 Query: 419 IVSLVFFGLNFTLFNFLIKKFNLPTPGRAGN---YIDNEDEASEGTGNVQDGSLATKVID 475 ++ + F + + +F L+ K NL TPGR + + ++ + + G Q S+ ++I+ Sbjct: 392 LIGIGQFAVYYVIFRTLVVKLNLKTPGREDDENVKLYSKADYRKKMGEPQ--SVTNEIIN 449 Query: 476 LLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGLIVKDKGVQAVYGPKADVL 535 LGGKENI VD C TRLRV + ++D+V + K GA G++ VQ +YG K + Sbjct: 450 GLGGKENIISVDNCFTRLRVAIHNMDLV-DDTILKSTGANGVVRNRNEVQVIYGVKVGQV 508 Query: 536 KSDIQDML 543 +S + L Sbjct: 509 RSRVDSWL 516 Lambda K H 0.325 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 647 Number of extensions: 44 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 545 Length of database: 519 Length adjustment: 35 Effective length of query: 510 Effective length of database: 484 Effective search space: 246840 Effective search space used: 246840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory