Align MalF, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate BWI76_RS06700 BWI76_RS06700 putative maltodextrin transport permease
Query= TCDB::Q8DT27 (453 letters) >FitnessBrowser__Koxy:BWI76_RS06700 Length = 435 Score = 253 bits (646), Expect = 9e-72 Identities = 141/424 (33%), Positives = 229/424 (54%), Gaps = 23/424 (5%) Query: 28 VIMGFANLMNKQFIKGLLFLLSEIAFLIAFVTQVIPAFSGLLTLGTKTQGMQEKIVDGVK 87 ++ GF ++Q++KG++FL+ +F+ F + GL TLG + Sbjct: 27 IVPGFGQFYHRQWLKGIVFLVLLSSFMSIFYDFLSEGLWGLYTLGEE------------- 73 Query: 88 LQVAVEGDNSMLMLIFGLASLIFCLVFAYIYWCNLKSARNLYMLKKEGRHIPSFKEDFMT 147 V DNS+ +L G+ S++ +Y+ +L+ A + EG + S ++ + Sbjct: 74 ----VPRDNSIFLLAEGIISVLIIAFGVLVYFLSLRDAWVNGKKRDEGVALNSVRKQYQM 129 Query: 148 LANGRFHMTLMFIPLIGVLLFTILPLVYMICLAFTNYDHNHLPPKSLFDWVGLANFGNVL 207 L + F ++ I ++ I P+++ +AFTNY+ H PP L DWVG NF N+ Sbjct: 130 LLSEGFPYLMITPGFILLVFVVIFPILFGFAIAFTNYNLYHTPPAKLVDWVGFKNFINIF 189 Query: 208 NGRM-AGTFFPVLSWTLIWAVFATVTNFLFGVILALIINAKGLKLKKMWRTIFVITIAVP 266 + TFF VL WT++W + AT GV+LA+++N K L+ K M RTIF++ AVP Sbjct: 190 TLSIWRSTFFDVLQWTVVWTLLATTLQCTVGVLLAILVNQKDLRFKPMIRTIFILPWAVP 249 Query: 267 QFISLLLMRNFLNDQGPL--NAFLEKIGLISHSLPFLSDPTWAKFSIIFVNMWVGIPFTM 324 F+++L+ ND + NA L G+ + +L+DP W K ++I + W+G PF Sbjct: 250 GFVTILVFAGMFNDSFGVINNAILSFFGISPKA--WLTDPFWTKTALIMMQTWLGFPFVF 307 Query: 325 LVATGIIMNLPSEQIEAAEIDGASKFQIFKSITFPQILLIMMPSLIQQFIGNINNFNVIY 384 + TG++ +P + EAA +DGAS F ++IT P +L + P +I Q+ N NNFN+IY Sbjct: 308 AMTTGVLQAIPDDLYEAATMDGASAFTRLRTITLPLVLYSIAPIIITQYTFNFNNFNIIY 367 Query: 385 LLTGGGPTNSQFYQAGSTDLLVTWLYKLTMNAADYNLASVIGIFIFAISAIFSLLAYTHT 444 L GGP + AG TD+LV+W+YKLTM+++ Y +A+ I I + +L + T Sbjct: 368 LFNNGGPAVAG-SNAGGTDILVSWIYKLTMSSSQYAIAATITILLSIFVVGLALWQFRAT 426 Query: 445 ASYK 448 S+K Sbjct: 427 KSFK 430 Lambda K H 0.329 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 435 Length adjustment: 32 Effective length of query: 421 Effective length of database: 403 Effective search space: 169663 Effective search space used: 169663 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory