Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate BWI76_RS06705 BWI76_RS06705 binding-protein-dependent transport system inner membrane protein
Query= reanno::Koxy:BWI76_RS01820 (296 letters) >FitnessBrowser__Koxy:BWI76_RS06705 Length = 283 Score = 168 bits (425), Expect = 1e-46 Identities = 95/289 (32%), Positives = 165/289 (57%), Gaps = 21/289 (7%) Query: 11 LRLFTTHLLLLVFIAAIMFPLLMVIAISLREGN-FATGSLIPESISWEHWRLALGFSVEH 69 +RL T L+++ I++PL+ + SL GN + S+IPE++S++H+ +V + Sbjct: 13 IRLSLTWLVVIFVSTMIIYPLVWTVGASLNAGNSLLSTSIIPENLSFQHYADLFNGNVNY 72 Query: 70 ADGRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQ 129 L W WNS+K++ +T + + + AYAF+R RF G+ L L+ Q Sbjct: 73 ------------LTWYWNSMKISFMTMVLTLISVSFTAYAFSRFRFKGRQNGLMLFLLLQ 120 Query: 130 MFPAVLSLVALYALFDRLGQYVPFVGLNTHGGVIFAYMGG-IALHVWTIKGYFETIDGSL 188 M P +L+A++ L LG +N+H ++ Y+GG I ++ W +KGY + I L Sbjct: 121 MIPQFSALIAIFVLSQLLGL------INSHLALVLIYVGGMIPMNTWLMKGYLDAIPKDL 174 Query: 189 EEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVG 248 +E+A +DGA+ ++ F +++PLS PILAVV + SF + + ++S +LR + YTL +G Sbjct: 175 DESARMDGASSFRIFFEIIMPLSKPILAVVALFSFTGPLGDFILSSTILRTPDKYTLPIG 234 Query: 249 MQQYL-NPQNYLWGDFAAAAVLSAIPITVVFLLAQRWLVNGLTAGGVKG 296 + + + +AA AVL A+P+ +++L Q++ V+GLT+G KG Sbjct: 235 LYNLVAQKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGSTKG 283 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 283 Length adjustment: 26 Effective length of query: 270 Effective length of database: 257 Effective search space: 69390 Effective search space used: 69390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory