Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate BWI76_RS03270 BWI76_RS03270 sugar ABC transporter ATP-binding protein CymD
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Koxy:BWI76_RS03270 Length = 376 Score = 347 bits (889), Expect = e-100 Identities = 200/389 (51%), Positives = 254/389 (65%), Gaps = 31/389 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M T+ L I KRY N +V +L+IHD EF+VFVGPSGC KSTTLRMIAGLEDI+ G Sbjct: 1 MATVSLRKIEKRYENG-FKAVHGIDLEIHDGEFMVFVGPSGCAKSTTLRMIAGLEDISGG 59 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 +YI ++ +ND PKDR IAMVFQNYALYPH +V++NMAFGLK++K KD+I +RV +AA Sbjct: 60 EIYIGNRKVNDLPPKDRGIAMVFQNYALYPHKTVFDNMAFGLKMQKRPKDEIKRRVEDAA 119 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 E L +TE L RKP ++SGGQRQRVA+GRAIVR VFL DEPLSNLDAKLRV+MR +IA+ Sbjct: 120 EKLEITELLYRKPKEMSGGQRQRVAVGRAIVRKPDVFLFDEPLSNLDAKLRVSMRMKIAQ 179 Query: 181 IHRRI-----GATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYN 235 +HR + AT IYVTHDQTEA+TL DRI +++ G I Q+ TP +LYN Sbjct: 180 LHRSLKEEGHPATMIYVTHDQTEALTLGDRICVLNH----------GNIMQVDTPTDLYN 229 Query: 236 EPANKFVAGFIGSPAMNFFEVTVEK--ERLVNQ--DGLSLALPQGQEKILEEKGYLGKKV 291 P NKFVA FIGSP++N + + K ERL + G+ + +P ++ +LE GY+ K V Sbjct: 230 YPNNKFVASFIGSPSINLIDTAIRKNNERLYVEIAPGVEILIPHSKQVLLE--GYINKPV 287 Query: 292 TLGIRPEDIS--SDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDS 349 GIRPE IS SD TF + V E +GSE LY G E ARV+ +D Sbjct: 288 CFGIRPEHISLASDDDDLNTFEGV-----LTVVENMGSEKFLYFIVGGKELIARVDTQDI 342 Query: 350 H--SPGEKVQLTFNIAKGHFFDLETEKRI 376 + G+ ++ N A H FD E + Sbjct: 343 NPFHIGKTLRFNLNTAFCHVFDFYNENNL 371 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 376 Length adjustment: 30 Effective length of query: 347 Effective length of database: 346 Effective search space: 120062 Effective search space used: 120062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory