Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate BWI76_RS17830 BWI76_RS17830 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Koxy:BWI76_RS17830 Length = 364 Score = 317 bits (813), Expect = 3e-91 Identities = 177/318 (55%), Positives = 217/318 (68%), Gaps = 5/318 (1%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 M +V SY A +K +L I DGEF VLVGPSGCGKST LRM+AGLE ++ G Sbjct: 1 MGSVVLNSVRKSYGDAH--VIKDVSLTIPDGEFCVLVGPSGCGKSTLLRMIAGLEEISGG 58 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 + I +++VT V P+ RDIAMVFQ+YALYP MTV ENMGFALK+A + EIN++V+EAA Sbjct: 59 EVHINERNVTEVEPKLRDIAMVFQSYALYPQMTVRENMGFALKMAKLPKAEINQKVNEAA 118 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 A LGL LER PK LSGGQRQRVAMGRAIVR PQVFL DEPLSNLDAKLR Q R +I Sbjct: 119 ALLGLEPLLERLPKDLSGGQRQRVAMGRAIVRKPQVFLFDEPLSNLDAKLRTQVRGEIRE 178 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 L R+L T+VYVTHDQ EA+TMG I VL+DG ++Q G P ELYDRPAN+FVAGFIGSP Sbjct: 179 LHRRLKTTSVYVTHDQIEAMTMGQMIVVLRDGRIEQAGTPLELYDRPANLFVAGFIGSPE 238 Query: 241 MN-LGTFSVKDGDATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLS 299 +N L V +G+ATS + A + D ++ RPE + ++ E+ D + Sbjct: 239 INQLPGEVVLNGNATSLRLKDGSLLALPAGLRVTDGQQVVYAIRPEQVNVV--HEARDDA 296 Query: 300 IPIKLDFVEELGSDSFLY 317 + K+ VE GSD L+ Sbjct: 297 LAAKVTAVENTGSDMQLF 314 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 20 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 364 Length adjustment: 30 Effective length of query: 346 Effective length of database: 334 Effective search space: 115564 Effective search space used: 115564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory