Align alpha-glucosidase (EC 3.2.1.20) (characterized)
to candidate BWI76_RS03235 BWI76_RS03235 alpha-glycosidase
Query= BRENDA::P21517 (604 letters) >FitnessBrowser__Koxy:BWI76_RS03235 Length = 598 Score = 198 bits (503), Expect = 6e-55 Identities = 139/428 (32%), Positives = 205/428 (47%), Gaps = 68/428 (15%) Query: 117 PQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWDEPVTAQAGGSTFYG 176 P+W I+YQIFP+RF P + ++ ++ W P ++ F G Sbjct: 152 PEWVKKTIWYQIFPERFCNGDPSISPEN-------------VQPWGTPPDSK----NFMG 194 Query: 177 GDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNT 236 GDL GI KL YL+ LGV LYL P+F A + HKYDT DY +VDP FGG+ L Sbjct: 195 GDLQGIINKLDYLQDLGVNGLYLCPIFTANASHKYDTVDYFNVDPHFGGNDRFKELVQKA 254 Query: 237 QQLGMRLVLDGVFNHSGD-SHAWFDRHNRGTGGACHNPESPWRDWYSF-------SDDGT 288 Q GM+++LD VFNH G+ S W D G +SP+ DW+ S D Sbjct: 255 HQRGMKVMLDAVFNHIGNQSPLWLDVVKNG-------DKSPYADWFWIKKFPVYPSGDKN 307 Query: 289 ALDWLGY--------ASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM 340 D+ + +PKL+ ++ + + + + + R+W++ +++DGWRLDV Sbjct: 308 EWDFRNFNYETFGNVIEMPKLNTENPACRDYLLQ----VARYWIE-EFDIDGWRLDVA-- 360 Query: 341 LGEAGGARNNMQHV--AGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF 398 N + H K +P+ YI+GE + + WL+ D D+ MNY Sbjct: 361 --------NEVDHEFWRAFRRTVKSIKPDCYILGEIWHEGMPWLRGDQFDSLMNY----- 407 Query: 399 PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGR 458 PL A TD + Q D +T + + + MFN L+SHDT+R +L G Sbjct: 408 PL--MQATTDY-FALQAYDKKTFIDIVTHAYLCYPRNVNEVMFNLLESHDTSRLLSLCGN 464 Query: 459 DIARLPLAVVWLFTWPGVPCIYYGDEVGLDGK---NDPFCRKPFPWQVEKQDTALFALYQ 515 D + LA +++F+ G PCIYYG EVG++G RK W +KQD + + Sbjct: 465 DKRKARLAYLFMFSQVGSPCIYYGSEVGMNGSRAMGSEDNRKCMIWDEQKQDLEFKSFIK 524 Query: 516 RMIALRKK 523 +I RKK Sbjct: 525 DLILWRKK 532 Lambda K H 0.322 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1126 Number of extensions: 68 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 604 Length of database: 598 Length adjustment: 37 Effective length of query: 567 Effective length of database: 561 Effective search space: 318087 Effective search space used: 318087 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory