Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate BWI76_RS03320 BWI76_RS03320 alcohol dehydrogenase
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__Koxy:BWI76_RS03320 Length = 352 Score = 297 bits (761), Expect = 3e-85 Identities = 158/349 (45%), Positives = 215/349 (61%), Gaps = 7/349 (2%) Query: 11 VKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGF---TTYP 67 +K FG+AA++ L+P F RRA + D+ +++ +CGVCHSD H I ++W T YP Sbjct: 1 MKTFGYAAQNAQSGLAPMSFERRALRDDDLAIEINYCGVCHSDLHQIRDDWRSWNPTVYP 60 Query: 68 IVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCEN--TIDTYG 125 +PGHEI+G V EVG V K+GD V +G +V SCR C+ C E C T+ Sbjct: 61 SIPGHEIIGTVIEVGPNVTHYKIGDAVAVGTIVDSCRVCDQCRRGEEQMCREFPTMTYNS 120 Query: 126 SIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGT 185 S DG T GGYS ++ E F+LR P+ L APLLCAGIT YSPL+ + + PG+ Sbjct: 121 SDRHDGKTTLGGYSKHIIVREEFVLRMPEGLDAARAAPLLCAGITVYSPLRTWNVG-PGS 179 Query: 186 KIGVVGLGGLGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGAR 245 ++GV+G+GGLGH+AVK A GA VTVI +E+K EA LGAD+ L+++ + MK A Sbjct: 180 RVGVIGIGGLGHLAVKFAAGLGAHVTVITRTEAKTAEA-RALGADTTLISNSDDAMKAAT 238 Query: 246 SSLDGIIDTVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGG 305 SS D IIDT+PV H ++ LL G LV+VGA L+ GR+ + G+ +GG Sbjct: 239 SSFDVIIDTIPVEHDVSAYVQLLDVEGALVIVGALGNMAGFNSLPLIMGRRCITGSPSGG 298 Query: 306 IKETQEMLDFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVIDIA 354 I ETQEMLDF K I + E+I + +N A ER+ + +V YRFVID+A Sbjct: 299 IAETQEMLDFCGKTGILPECEMIAIAEINEAFERMERGEVHYRFVIDMA 347 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 352 Length adjustment: 29 Effective length of query: 336 Effective length of database: 323 Effective search space: 108528 Effective search space used: 108528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory