Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate BWI76_RS05645 BWI76_RS05645 fructuronate reductase
Query= BRENDA::O08355 (493 letters) >FitnessBrowser__Koxy:BWI76_RS05645 Length = 491 Score = 355 bits (912), Expect = e-102 Identities = 196/470 (41%), Positives = 271/470 (57%), Gaps = 6/470 (1%) Query: 15 VKLPAYTLADTRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSICGVGLR-SEDRKAR 73 V PA+ + I H+G G FHRAHQA YT L+ T + DW IC V L DR Sbjct: 12 VTRPAWDRSRLESRIVHLGCGAFHRAHQALYTHHLLETSDS-DWGICEVNLMPGNDRVLI 70 Query: 74 DDLAGQDYLFTLYELGDTDDTEVRVIGSISDMLLAE-DSAQALIDKLASPEIRIVSLTIT 132 ++L Q L+T+ E G D TE+++IGS+ + L E D + ++ + P IVSLT+T Sbjct: 71 ENLKNQQLLYTVAEKG-ADSTELKIIGSMKEALHPEIDGCEGILRAMTRPHTAIVSLTVT 129 Query: 133 EGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQRRAAGIPAFTVMSCDNL 192 E GYC D ++G+ + P IQHDLA+P++PK+ G+I AL RR G+ AFTVMSCDN+ Sbjct: 130 EKGYCTDAASGQLDLNNPLIQHDLANPATPKSAIGYIVEALRLRREEGLNAFTVMSCDNV 189 Query: 193 PHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAMVDRITPMTSTAHRLQLHDEHGIDD 252 NG V + A+L A + +L WI+AH +FP MVDRI P + ++ D+ G+ D Sbjct: 190 RENGHVAKVAVLGLAQARDPQLAAWIEAHATFPCTMVDRIVPAATPETLQEIADQLGVYD 249 Query: 253 AWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKIGLLNGSHLALTYLGFL 312 + CEPF QWV+ED FVNGRPAW+KVG QF +DV P+E MK+ +LNGSH L YLG+L Sbjct: 250 PCAIACEPFRQWVIEDSFVNGRPAWDKVGAQFVEDVVPFEMMKLRMLNGSHSFLAYLGYL 309 Query: 313 KGYRFVHETMNDPLFVAYMRAYMDLDVTPNLAPVPGIDLTDYKQTLVDRFSNQAIADQLE 372 GY + +TM +P + A M + P L+ G DL Y L+ RFSN ++ + Sbjct: 310 GGYETIADTMTNPAYRKAALALMMQEQAPTLSMPEGTDLQAYATLLIARFSNPSLRHRTW 369 Query: 373 RVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKGVDENGVSYTIPDP-RA 431 ++ DGS K P+ + I + +G + AL VA W Y G+DE G + DP +A Sbjct: 370 QIAMDGSQKLPQRLLDPIRLHLQNGSDWRHLALGVAGWMRYTLGIDEQGQPIDVVDPLQA 429 Query: 432 EFCQ-GLVSDDALISQRLLAVEEIFGTAIPNSPEFVAAFERCYGSLRDNG 480 EF Q +A LLA+ IF +P++ EFV A + Y LR G Sbjct: 430 EFQQINQRYQEAERVPALLAISGIFAHDLPDNSEFVNAVTQAYQQLRKRG 479 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 491 Length adjustment: 34 Effective length of query: 459 Effective length of database: 457 Effective search space: 209763 Effective search space used: 209763 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory