Align ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, permease component 1 (characterized)
to candidate BWI76_RS01820 BWI76_RS01820 maltose transporter permease
Query= reanno::WCS417:GFF2491 (276 letters) >FitnessBrowser__Koxy:BWI76_RS01820 Length = 296 Score = 89.0 bits (219), Expect = 1e-22 Identities = 75/254 (29%), Positives = 110/254 (43%), Gaps = 25/254 (9%) Query: 31 WMVLTSFKTE-IDAFATPPQFIFTPTLENYLHINERSNYFSYAWNSVLISFSATALCLLI 89 W + F E D TPP F P L + WNS+ ++ + + Sbjct: 59 WRLALGFSVEHADGRVTPPPF---PVL-------------LWLWNSIKVAGITAIGIVAL 102 Query: 90 SVPAAYSMAFYETQRTKGTLLWMLSTKMLPPVGVLMPIYLLAKSFGL------LDTRIAL 143 S AY+ A L ML +M P V L+ +Y L G L+T + Sbjct: 103 STTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGQYVPFVGLNTHGGV 162 Query: 144 IIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQEMVRVLLPIAKGGLASTVLL 203 I Y + + + VW + YF+ I + EAA LDGAT WQ VLLP++ LA +L Sbjct: 163 IFAY-MGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFIL 221 Query: 204 SLILCWNEA-FWSLNLTSSSAAPLTALIASYSSPEGLFWAKLSAVSTLACAPILIFGWIS 262 S I E SL L ++ L + Y +P+ W +A + L+ PI + ++ Sbjct: 222 SFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLLA 281 Query: 263 QKQLVRGLSFGAVK 276 Q+ LV GL+ G VK Sbjct: 282 QRWLVNGLTAGGVK 295 Lambda K H 0.327 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 296 Length adjustment: 26 Effective length of query: 250 Effective length of database: 270 Effective search space: 67500 Effective search space used: 67500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory