Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate BWI76_RS26290 BWI76_RS26290 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= TCDB::O30494 (367 letters) >FitnessBrowser__Koxy:BWI76_RS26290 Length = 356 Score = 344 bits (882), Expect = 2e-99 Identities = 183/356 (51%), Positives = 246/356 (69%), Gaps = 6/356 (1%) Query: 1 MANLKIKNLQKGFEGFS-IIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGT 59 MA LK++ + K ++G + +I+ + L+V D EF+V VGPSGCGKSTLLR++AGLE V+ G Sbjct: 1 MAGLKLQAVTKSWDGKTQVIQPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTSGD 60 Query: 60 IELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAAR 119 I +D + +TE+ P R +AMVFQ YALYPHMSV +NM++ L + G+ K L+ +V EAAR Sbjct: 61 IWIDRKRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGLGKGLIAERVQEAAR 120 Query: 120 ILELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARL 179 ILEL LL+R+P++LSGGQRQRVA+GRAIVR+P +FLFDEPLSNLDA LRVQMRLEL L Sbjct: 121 ILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQHL 180 Query: 180 HKELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKM 239 H+ L+ T +YVTHDQVEAMTLA +V+V+N G EQ+G+P+E+Y +PA+ FVA F+G+P M Sbjct: 181 HRRLKTTSLYVTHDQVEAMTLAQRVMVMNKGVAEQIGTPVEVYEKPASRFVASFIGSPAM 240 Query: 240 GFLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVTLGIRPEHLEIASPGQTTLT 299 L+G RV G +L G L+ + S G +TLGIRPEH ++S + + Sbjct: 241 NLLEG---RVSDDGSRFELAGGMLLPIN-SEHRRYAGRKMTLGIRPEHFALSSQAEGGVP 296 Query: 300 VTADVGERLGSDTFCHVITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFDTD 355 + D E LG+D H + L +R+ Q G TL LHL HLFD++ Sbjct: 297 LVMDTLEILGADNLAHGRWGE-QKLVVRLPHQQRPQAGSTLWLHLPQESLHLFDSE 351 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 356 Length adjustment: 29 Effective length of query: 338 Effective length of database: 327 Effective search space: 110526 Effective search space used: 110526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory