Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate BWI76_RS00655 BWI76_RS00655 inner-membrane translocator
Query= uniprot:D8IZC8 (344 letters) >FitnessBrowser__Koxy:BWI76_RS00655 Length = 334 Score = 194 bits (493), Expect = 3e-54 Identities = 122/320 (38%), Positives = 177/320 (55%), Gaps = 17/320 (5%) Query: 26 QWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTF 85 Q L HR +L +++L + G +F S N + + AI ++LA G Sbjct: 4 QLLKHREALLAAVIILMI-------GAIGSRAPSFVSPGNLVEMFNDTAILIILALGQMM 56 Query: 86 VILTAGIDLSVGSVLAVSAVLGMQVSLGAAPGWAIP------MFIFSGLVMGMVNGAMVA 139 V+LT GIDLS+ + LA++ GM V+L A IP + GL+MGM+NG +V Sbjct: 57 VLLTKGIDLSMAANLALT---GMIVALLNAHYPGIPVAALLALATLLGLLMGMINGLLVW 113 Query: 140 LLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPS-FEWIGNGDFLHVPWLIWVAVAV 198 L I A VVTLGTM+ +RG +LL+DG V ++ + + F + L +P L W A+A Sbjct: 114 RLGIPAIVVTLGTMSIYRGIIFLLSDGGWVNSHQMSADFLGLPRASLLGLPLLSWCAIAA 173 Query: 199 VLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRL 258 +LL LR + G +Y GGN AA TGI G + + +SG +G G + SR Sbjct: 174 LLLVGYFLRYSRTGRALYTAGGNATAAYYTGINAGKMQFVSFCLSGALAGFCGYLWISRF 233 Query: 259 YGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQ 318 A + +G+EL +AA V+GG S MGG G + G + GAL +GV+NN L ++G+S FWQ Sbjct: 234 AVAYVDVANGFELQVVAACVIGGISTMGGTGRVLGCLCGALFLGVINNALPVIGISPFWQ 293 Query: 319 YVAKGAVIVLAVILDKWRQK 338 GAVIV+AV+L++ K Sbjct: 294 MAISGAVIVIAVLLNERSNK 313 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 334 Length adjustment: 28 Effective length of query: 316 Effective length of database: 306 Effective search space: 96696 Effective search space used: 96696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory