Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate BWI76_RS22415 BWI76_RS22415 transcriptional regulator
Query= SwissProt::P23917 (302 letters) >FitnessBrowser__Koxy:BWI76_RS22415 Length = 304 Score = 275 bits (703), Expect = 9e-79 Identities = 141/298 (47%), Positives = 188/298 (63%), Gaps = 6/298 (2%) Query: 1 MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTV 60 + +G+D+GGTK E + L AGE +YR R PT ++ Y ++ + L++ + + T+ Sbjct: 2 LHLGLDIGGTKMEAVLLNAAGECVYRQRRPTHKESYDAFMQQLLGLIESVRAWSERPFTL 61 Query: 61 GMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAA 120 G+G+PG+I P +G++KN N LNG DL L + V +ANDA+C +SEAVDGA A Sbjct: 62 GIGLPGAIDPQSGLIKNCNCLVLNGHDLRHDLMRELGQSVWMANDADCFTLSEAVDGAGA 121 Query: 121 GAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGK 180 GA TVF VIIGTGCG GVA N R G N AGEWGHNPLP + R PCYCGK Sbjct: 122 GATTVFGVIIGTGCGGGVAVNQRLLSGPNAIAGEWGHNPLPGYRPE--RDGPAQPCYCGK 179 Query: 181 QGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVV 240 + CIE+FISGTGFA Y G + II + P+A R + A+SLA V+ Sbjct: 180 ENCIESFISGTGFARRY----GAQARSEAIIAAAQNGAPLALAHWRHFIDAFARSLASVI 235 Query: 241 NILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWL 298 NILDP VIVLGGG+SNV ++Y+ + I ++F C T +++A+ GD+SGVRGAAWL Sbjct: 236 NILDPQVIVLGGGLSNVGQIYEQLPSAIVPYLFSDSCRTQIKQARFGDASGVRGAAWL 293 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 304 Length adjustment: 27 Effective length of query: 275 Effective length of database: 277 Effective search space: 76175 Effective search space used: 76175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory