Align Mannokinase (EC 2.7.1.7) (characterized)
to candidate BWI76_RS27555 BWI76_RS27555 putative sugar kinase/transcriptional regulator, ATPase domain protein
Query= reanno::Smeli:SMc03109 (298 letters) >FitnessBrowser__Koxy:BWI76_RS27555 Length = 310 Score = 239 bits (609), Expect = 8e-68 Identities = 125/295 (42%), Positives = 179/295 (60%), Gaps = 1/295 (0%) Query: 2 FIGIDWGGTKMEVIALDRDGETRARHRVPTPTSGYEDCIRAVVELVASAESTAGERGSIG 61 ++G+D GG+K+ + +D G R RV T + I +VEL+ + + +IG Sbjct: 3 YLGLDIGGSKIAAVVMDEQGHEWRRFRVETRKQTRQQFIATLVELITAIGDELAQPLAIG 62 Query: 62 IGIPGSPNPRTGIVRNSNAVLINGKPLGRDLAAALGREVRLANDANCLAVSEAVDGAGKD 121 I +PGS +P++G +RN+N +ING L +L LG+ V LAND NC A+SEA DGAG D Sbjct: 63 IALPGSISPQSGKIRNANIQVINGCRLQDELEQRLGQSVVLANDGNCFALSEACDGAGAD 122 Query: 122 AGVVFGVIVGTGHGGGLAIGKKVHAGYQGVAAEIGHYPLP-WMTKDEYPGHRCWCGKLGC 180 +VFG+ +GTG GGG+A+ +++ G G+AAE GH LP + ++ P RC+CGK C Sbjct: 123 YSLVFGMTLGTGCGGGIALNRQIFPGASGIAAECGHITLPGYQEVNDGPPARCYCGKYNC 182 Query: 181 LDMYACGTGLELDYRMTTGTDRRGRDIIEAKRAGDPVAIGVYGRFVDRLARSLALLTNIV 240 ++ + GTGL YR+ T + II G+ A RF +LAR+LA + N++ Sbjct: 183 VESFISGTGLSARYRLLTQEALSSQAIIARALEGEHAACEQVLRFRQQLARTLATVVNLI 242 Query: 241 DPDVFVLGGGMSNVDEIYGELPASITRYLFGDSFETPIRKAVHGDSSGVRGAAWL 295 DP V +LGGG+SNV + +L A + +F D F TPI A HGDSSG+RGAAWL Sbjct: 243 DPGVIILGGGLSNVALLVNDLEADVAPLVFTDHFITPIVPARHGDSSGMRGAAWL 297 Lambda K H 0.319 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 310 Length adjustment: 27 Effective length of query: 271 Effective length of database: 283 Effective search space: 76693 Effective search space used: 76693 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory