Align Inositol transport system ATP-binding protein (characterized)
to candidate BWI76_RS07240 BWI76_RS07240 D-ribose transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Koxy:BWI76_RS07240 Length = 494 Score = 170 bits (430), Expect = 6e-47 Identities = 93/246 (37%), Positives = 146/246 (59%), Gaps = 6/246 (2%) Query: 8 IRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFE 67 + +GI K F V AL VS+ V PG H L+G+NGAGKST +K + G+++P KG I + Sbjct: 6 LEAEGISKFFPGVKALDNVSLRVRPGTVHALMGENGAGKSTLMKCLIGIYRPDKGAIRVK 65 Query: 68 GQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRI 127 G+P+ F D DA+ +GI+ +HQ L ++P M+V+ N ++G EP++ DH R Sbjct: 66 GEPVQFQDTMDALRSGISMIHQELNLVPHMTVAENIWLGREPMK----YGFVDHRQLARQ 121 Query: 128 TMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANV 187 T + + K+ I L D+ VG LS +Q V IA+AV + A ++I+DEPTSAL + A++ Sbjct: 122 TQDLLDKLNIRL-SADRLVGELSIASQQMVEIAKAVSWNADIVIMDEPTSALTESEVAHL 180 Query: 188 LATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAGG 247 I +R+QG A+++I+H + A+ D +V G +G+ Q + + + L M G Sbjct: 181 FTIIRDLRQQGKAIIYISHKMDEIFAITDEISVFRDGTWVGSKQTTEFTRQSLITQMV-G 239 Query: 248 QELATL 253 +EL L Sbjct: 240 RELTQL 245 Score = 102 bits (254), Expect = 2e-26 Identities = 65/222 (29%), Positives = 109/222 (49%), Gaps = 4/222 (1%) Query: 22 ALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIA 81 A ++ V GE + G GAG+S ++++ G+ K G++L +G P++ P AI Sbjct: 268 AFHDINFSVRRGEILGVAGLVGAGRSEVMESLFGMEKADSGEVLIDGMPVNIDSPSTAIE 327 Query: 82 AGIATV---HQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGIN 138 G+A + + + ++SV N + P IG H ME++R++ I Sbjct: 328 KGMALLTEDRKKSGLFLVLSVLENMSIVKMP-EYIGKTGFVQHLKMAEDCMEQIRRLNIK 386 Query: 139 LRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQG 198 DQ + LSGG +Q V IAR + K+LILDEPT + V A + I ++ +G Sbjct: 387 TPTMDQIINNLSGGNQQKVLIARWLLAQPKILILDEPTRGIDVGAKAEIYHLISELANRG 446 Query: 199 VAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL 240 VAV+ ++ + L + DR V++ G+ G + D E + Sbjct: 447 VAVIMVSSELPEILGMSDRVMVMHEGRITGILDKEDADQETI 488 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 494 Length adjustment: 29 Effective length of query: 232 Effective length of database: 465 Effective search space: 107880 Effective search space used: 107880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory