Align Inositol ABC transporter, periplasmic inositol-binding protein IbpA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate BWI76_RS00285 BWI76_RS00285 D-ribose ABC transporter substrate-binding protein
Query= TCDB::B8H228 (326 letters) >FitnessBrowser__Koxy:BWI76_RS00285 Length = 296 Score = 154 bits (390), Expect = 2e-42 Identities = 93/298 (31%), Positives = 164/298 (55%), Gaps = 14/298 (4%) Query: 6 MSRRRLLGLAAGLGLGTAALGLMTGCARGGAEAEVVVSFNDLSQPFFVAMRRELEDEAAK 65 M+ ++L L + + L T A A+ + + + L+ PFFV+++ + EA K Sbjct: 1 MNMKKLATLVSAVALSA------TVSANAMAKDTIALVISTLNNPFFVSLKEGAQKEADK 54 Query: 66 LGVKVQVLDAQNNSSKQISDLQAAAVQGAKVVIVAPTDSKALAGAADDLVEQGVAVISVD 125 LG + VLD+QNN +K+++++Q V+G K++++ PTDS A+ A + + VI++D Sbjct: 55 LGYNLVVLDSQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKLANQAKIPVITLD 114 Query: 126 RNIAGGKTAVPHVGADNVAGGRAMADWVVKTYPAGARVVVITNDPGSSSSIERVKGVHDG 185 R + G V H+ +DNV GG+ D++ K A+++ + G+S++ ER +G Sbjct: 115 RQASKG-DVVSHIASDNVLGGKMAGDYIAKKVGENAKIIELQGIAGTSAARERGEGFQQA 173 Query: 186 LAAGGPAFKIVTEQTANSKRDQALTVTQNILTSMRDTPPDVILCLNDDMAMGALEAVRAA 245 +AA F ++ Q A+ R + L V QN+LT+ D + ND+MA+GAL A++ A Sbjct: 174 VAA--HKFNVLASQPADFDRTKGLNVMQNLLTAHPDV--QAVFAQNDEMALGALRALQTA 229 Query: 246 GLDSAKVKVIGFDAIPEALARIKAGEMVATVEQNPGLQIRTALRQAVDKIKSGAALKS 303 G + V V+GFD P+ + +G++ AT+ Q P QI + DK+ G +++ Sbjct: 230 G--KSDVMVVGFDGTPDGEKAVNSGKLAATIAQLPE-QIGVKGVETADKVLKGEKVET 284 Lambda K H 0.315 0.130 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 296 Length adjustment: 27 Effective length of query: 299 Effective length of database: 269 Effective search space: 80431 Effective search space used: 80431 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory