Align Inosose dehydratase; 2-keto-myo-inositol dehydratase; 2KMI dehydratase; EC 4.2.1.44 (characterized)
to candidate BWI76_RS03105 BWI76_RS03105 myo-inosose-2 dehydratase
Query= SwissProt::P42416 (297 letters) >FitnessBrowser__Koxy:BWI76_RS03105 Length = 299 Score = 281 bits (720), Expect = 1e-80 Identities = 141/294 (47%), Positives = 194/294 (65%), Gaps = 6/294 (2%) Query: 1 MGKNEILWGIAPIGWRNDDMPEIGAGNTLQHLLSDIVVARFQGTEVGGFFP-EPAILNKE 59 M K+ + IAPIGW NDDMPE+G+ NT Q ++S++ +A F G+EVG +P +PA+L Sbjct: 1 MNKDNVKLAIAPIGWTNDDMPELGSENTFQQIVSEMALAGFTGSEVGSKYPRDPAVLKPM 60 Query: 60 LKLRNLRIAGKWFSSFILRDGLGEAAKTFTLHCEYLQQVNADVAVVSEQTYSVQSLEKNV 119 L +R ++I WFS+F + F H +L + A V SEQ+ S+Q LEK + Sbjct: 61 LDIRGIQICNAWFSTFFANGQREKTIDEFVNHMNFLHAMGAKVIGCSEQSGSIQGLEKPI 120 Query: 120 FTE-KPHFTDDEWERLCEGLNHLGEIAAQHGLKLVYHHHLGTGVQTAEEVDRLMAGTDPA 178 KP F+++EW+R+ EG N LG +AA+ G+++ HHH+GTG+QT E+D+ M+ D Sbjct: 121 LENAKPCFSEEEWQRVAEGYNTLGRLAAEKGMQVCLHHHMGTGIQTTAEIDKFMSLVDDK 180 Query: 179 HVHLLYDTGHAYISDGD---YMGMLEKHIGRIKHVHFKDARLNVMEQCRLEGQSFRQSFL 235 V LLYDTGHA+ S+G + +L+K++ RI HVH KD R V+EQ R EG SF Sbjct: 181 -VFLLYDTGHAWYSEGGEEPMLAILKKYLPRINHVHLKDVRPPVIEQVRREGLSFLDGVK 239 Query: 236 KGMFTVPGDGCIDFREVYQLLLKHSYSGWIVIEAEQDPDVANPLEYALIARNYI 289 KG FTVPGDG IDFR V++LL +H Y GW+V+EAEQDP +ANP EYA+ AR YI Sbjct: 240 KGTFTVPGDGVIDFRPVFKLLDEHGYKGWMVVEAEQDPALANPFEYAVKARKYI 293 Lambda K H 0.321 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 299 Length adjustment: 27 Effective length of query: 270 Effective length of database: 272 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS03105 BWI76_RS03105 (myo-inosose-2 dehydratase)
to HMM TIGR04379 (iolE: myo-inosose-2 dehydratase (EC 4.2.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04379.hmm # target sequence database: /tmp/gapView.10172.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04379 [M=290] Accession: TIGR04379 Description: myo_inos_iolE: myo-inosose-2 dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-121 390.5 0.0 3.3e-121 390.3 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS03105 BWI76_RS03105 myo-inosose-2 dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS03105 BWI76_RS03105 myo-inosose-2 dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 390.3 0.0 3.3e-121 3.3e-121 1 289 [. 5 296 .. 5 297 .. 0.96 Alignments for each domain: == domain 1 score: 390.3 bits; conditional E-value: 3.3e-121 TIGR04379 1 kvklgiaPiaWvndDlpelggdttleqvlseaaeagfsgtElgnkfpkdpavLkaaleerglelvsgwfsa 71 +vkl+iaPi W+ndD+pelg+++t++q++se+a agf+g+E+g+k+p+dpavLk++l+ rg+++++ wfs+ lcl|FitnessBrowser__Koxy:BWI76_RS03105 5 NVKLAIAPIGWTNDDMPELGSENTFQQIVSEMALAGFTGSEVGSKYPRDPAVLKPMLDIRGIQICNAWFST 75 59********************************************************************* PP TIGR04379 72 llleksveeeieavrehlellkalgakvivvaEvgksiqgdkdtplaer.pklteeeweelaeklnklgei 141 ++++ ++e++i+++ +h+++l+a+gakvi ++E+++siqg ++ l++ p ++eeew+++ae+ n+lg++ lcl|FitnessBrowser__Koxy:BWI76_RS03105 76 FFANGQREKTIDEFVNHMNFLHAMGAKVIGCSEQSGSIQGLEKPILENAkPCFSEEEWQRVAEGYNTLGRL 146 ****************************************97777766579******************** PP TIGR04379 142 lkekglklayHhHlgtvveteeeidrlmeltdpelvgllyDtGHlvfa..gedp.lavlekyadRiahvHl 209 ++ekg+++ HhH+gt+++t++eid++m+l d++ v llyDtGH+ ++ ge+p la+l+ky Ri+hvHl lcl|FitnessBrowser__Koxy:BWI76_RS03105 147 AAEKGMQVCLHHHMGTGIQTTAEIDKFMSLVDDK-VFLLYDTGHAWYSegGEEPmLAILKKYLPRINHVHL 216 *********************************9.***********973245552699************* PP TIGR04379 210 KDvRkevleevrkekksFldavlkGvftvPGdGcidfeeilealkakdYeGWlvvEaEqDPakaepleyak 280 KDvR+ v+e+vr+e sFld+v+kG ftvPGdG idf+++++ l++++Y+GW+vvEaEqDPa a+p+eya lcl|FitnessBrowser__Koxy:BWI76_RS03105 217 KDVRPPVIEQVRREGLSFLDGVKKGTFTVPGDGVIDFRPVFKLLDEHGYKGWMVVEAEQDPALANPFEYAV 287 *********************************************************************** PP TIGR04379 281 kakkyleel 289 ka+ky++e+ lcl|FitnessBrowser__Koxy:BWI76_RS03105 288 KARKYIRET 296 ******986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.33 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory