Align Myo-inosose-2 dehydratase (EC 4.2.1.44) (characterized)
to candidate BWI76_RS10210 BWI76_RS10210 endonuclease
Query= reanno::BFirm:BPHYT_RS13920 (305 letters) >FitnessBrowser__Koxy:BWI76_RS10210 Length = 298 Score = 231 bits (590), Expect = 1e-65 Identities = 129/282 (45%), Positives = 163/282 (57%), Gaps = 4/282 (1%) Query: 6 VRIGINPLSWMNDDLPSLGGETPLEVALTEGREIGYQGFELGNKFPREPQALKSLLAQYD 65 + +G++PLSW ND L LGG PLE L E E GY+G ELG KFPR L +L Q Sbjct: 7 IHVGVSPLSWTNDVLEDLGGYIPLETCLAEAAEAGYEGIELGRKFPRTIDTLAPVLNQAK 66 Query: 66 LALVSGWYSGRLARRSVEEEIAEVGPHLELLAQNGATAMVYGEVA--DSIQGAAQPLYQR 123 L L SGWY+G LA+RS E+E+A V H LL GA MVYGE + +PL + Sbjct: 67 LKLASGWYNGLLAKRSFEDELAAVHDHAMLLKSLGAKVMVYGECGAMPGLTPLDEPLSKS 126 Query: 124 PRFFSEKQWADYAARVDEFARYTLSR-GVRLAYHHHMGAYVETPADVDQLMARTSDAVGL 182 P + YA +V+ A L G+RLAYHHH+ VET ++ + T+D VG+ Sbjct: 127 PPL-GHIELPQYAEKVNNLAVSLLKNYGLRLAYHHHLMMVVETDDELKAFLKATNDLVGI 185 Query: 183 LFDAGHITFAGGDPLAVLDKHIGRVCHVHCKDVRPAVMKLARNRNWSFLDAVIAGAFTVP 242 D GH T AG D VL+ + RV HVH KDVR V+ N N SF +AV AG FTVP Sbjct: 186 ALDCGHATVAGVDINWVLENYGNRVAHVHLKDVRGEVLNNVINNNLSFNNAVRAGLFTVP 245 Query: 243 GDGAVNFPAIIERLKRHGYCGWLVVEAEQDPVVAPSFEYAQK 284 G+G VN+ +I LK Y GW+++EAEQDP AP E +K Sbjct: 246 GEGIVNYAPVIHFLKNSTYEGWIIIEAEQDPEKAPPLETVKK 287 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 298 Length adjustment: 27 Effective length of query: 278 Effective length of database: 271 Effective search space: 75338 Effective search space used: 75338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS10210 BWI76_RS10210 (endonuclease)
to HMM TIGR04379 (iolE: myo-inosose-2 dehydratase (EC 4.2.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04379.hmm # target sequence database: /tmp/gapView.15207.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04379 [M=290] Accession: TIGR04379 Description: myo_inos_iolE: myo-inosose-2 dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-100 323.0 0.0 1.1e-100 322.9 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS10210 BWI76_RS10210 endonuclease Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS10210 BWI76_RS10210 endonuclease # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 322.9 0.0 1.1e-100 1.1e-100 2 288 .. 7 294 .. 6 296 .. 0.96 Alignments for each domain: == domain 1 score: 322.9 bits; conditional E-value: 1.1e-100 TIGR04379 2 vklgiaPiaWvndDlpelggdttleqvlseaaeagfsgtElgnkfpkdpavLkaaleerglelvsgwfsal 72 +++g++P++W+nd l++lgg ++le++l+eaaeag++g+Elg+kfp++ ++L+++l++ +l+l+sgw+ +l lcl|FitnessBrowser__Koxy:BWI76_RS10210 7 IHVGVSPLSWTNDVLEDLGGYIPLETCLAEAAEAGYEGIELGRKFPRTIDTLAPVLNQAKLKLASGWYNGL 77 789******************************************************************** PP TIGR04379 73 lleksveeeieavrehlellkalgakvivvaEvgksiqgdk.dtplaerpklteeeweelaeklnklge.i 141 l+++s+e+e++av++h+ llk+lgakv+v++E+g ++ d+pl++ p l + e+ ++aek+n+l+ + lcl|FitnessBrowser__Koxy:BWI76_RS10210 78 LAKRSFEDELAAVHDHAMLLKSLGAKVMVYGECGAMPGLTPlDEPLSKSPPLGHIELPQYAEKVNNLAVsL 148 *********************************9887665437889999******************9626 PP TIGR04379 142 lkekglklayHhHlgtvveteeeidrlmeltdpelvgllyDtGHlvfagedplavlekyadRiahvHlKDv 212 lk++gl+layHhHl vvet +e++ ++++t++ vg+ +D GH+++ag d vle+y++R+ahvHlKDv lcl|FitnessBrowser__Koxy:BWI76_RS10210 149 LKNYGLRLAYHHHLMMVVETDDELKAFLKATNDL-VGIALDCGHATVAGVDINWVLENYGNRVAHVHLKDV 218 789****************************976.************************************ PP TIGR04379 213 RkevleevrkekksFldavlkGvftvPGdGcidfeeilealkakdYeGWlvvEaEqDPakaepleyakkak 283 R evl++v +++ sF +av++G+ftvPG+G ++++++++ lk++ YeGW+++EaEqDP+ka+ple kka+ lcl|FitnessBrowser__Koxy:BWI76_RS10210 219 RGEVLNNVINNNLSFNNAVRAGLFTVPGEGIVNYAPVIHFLKNSTYEGWIIIEAEQDPEKAPPLETVKKAR 289 **********************************************************************9 PP TIGR04379 284 kylee 288 +++ lcl|FitnessBrowser__Koxy:BWI76_RS10210 290 AWVKS 294 98775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (298 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory