Align inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate BWI76_RS07225 BWI76_RS07225 putative oxidoreductase
Query= BRENDA::O68965 (330 letters) >FitnessBrowser__Koxy:BWI76_RS07225 Length = 335 Score = 216 bits (550), Expect = 6e-61 Identities = 126/330 (38%), Positives = 196/330 (59%), Gaps = 5/330 (1%) Query: 3 VRFGLLGAGRIGKVHAKAVSGNADARLVAVADAFPAAAEAIAGAYGCEVRTI-DAIEAAA 61 +RF LLG+G IG+VHA +++ + L VADA P A+A+A YG T+ +AI + A Sbjct: 4 IRFALLGSGFIGQVHAASLARHERTVLSMVADADPERAKALASRYGARAVTVAEAINSDA 63 Query: 62 DIDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDAERVRACLKVVSDTKAKLMVGFN 121 IDAV+I + T +HA L+ ARAGKA++CEKPIDL R R ++ V + VGFN Sbjct: 64 -IDAVLIASSTPSHAALLAAAARAGKAVYCEKPIDLSLARARQVVEKVLPLGVPVTVGFN 122 Query: 122 RRFDPHFMAVRKAIDDGRIGEVEMVTITSRDPSAPPVDYIKRSGGIFRDMTIHDFDMARF 181 RRFD +R+ I+ G IG++E+V + R PP++Y++ SGG RD IH FD+ RF Sbjct: 123 RRFDASHQQLRREIEAGVIGKIELVQMVCRASIMPPLEYLRSSGGQMRDQAIHFFDLLRF 182 Query: 182 LLGEEPVSVTATAAVLIDKAIGDAGDYDSVSVILQTASGKQAIISNSRRATYGYDQRIEV 241 L G+E +V A L I + D D+ ++L+ G A + N+RR +GYD+RI + Sbjct: 183 LTGDEVTTVAAMGDALALAEIAEFDDVDTSILMLRMRGGAMAQLDNTRRTGHGYDERISL 242 Query: 242 HGSKGAVAAENQRPVSIEIATGDGYTRPPLHDFFMTRYTEAYANEIESFIAAIEKGAEIA 301 GS G + + +Q + + G+ +P L+ + +R +Y +++F+ ++ G E+A Sbjct: 243 LGSDGVLESGSQTTRGVTLWQGERRIQPGLYPDWFSRVEGSYYAHLDAFVRSL-GGEEVA 301 Query: 302 --PSGNDGLAALALADAAVRSVAEKRQISI 329 P DGL A A+A+AAV S+ + + +S+ Sbjct: 302 DLPGLLDGLRAQAIAEAAVLSLQQGQFVSV 331 Lambda K H 0.320 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 335 Length adjustment: 28 Effective length of query: 302 Effective length of database: 307 Effective search space: 92714 Effective search space used: 92714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory