Align D-mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate BWI76_RS23640 BWI76_RS23640 mannonate dehydratase
Query= metacyc::MONOMER-17955 (360 letters) >FitnessBrowser__Koxy:BWI76_RS23640 Length = 355 Score = 461 bits (1187), Expect = e-134 Identities = 212/356 (59%), Positives = 272/356 (76%), Gaps = 1/356 (0%) Query: 1 MKLVFRWYGEKHDTVTLEQIRQIPGVEGVVGALFDIPVGEVWPFEEIMKLKETVEKAGLK 60 M++ RW+G + D + LE IRQ+PGVEGVVGAL+D+ GEVWP E+I L E AGLK Sbjct: 1 MQMTMRWFGPQEDKIPLEYIRQVPGVEGVVGALYDVAPGEVWPVEKIKALIEQAHAAGLK 60 Query: 61 LEVIESVNVHEDIKLGLPTRDRYIENYKKTIRNLAKAGVKVVCYNFMPVFDWMRTDLHKK 120 +EVIESVN+H+DIK+G RDRYI+NYK+TIRNLA GVKV+CYNFMPVFDWM+TD++ Sbjct: 61 MEVIESVNIHDDIKIGSAERDRYIDNYKQTIRNLAGFGVKVICYNFMPVFDWMKTDMNYV 120 Query: 121 LPDGSETMEYDHRLIEGVTPDELIKRVKEGSQGFVLPGWEWDRLEKLRETFELYKNVDEE 180 LPDGS TM ++ R I+ D ++K V E + GF LPGWE +RL K++E F Y++VD+ Sbjct: 121 LPDGSLTMAFEKRGIDKSLED-VVKEVLENANGFALPGWEPERLAKVQELFARYRDVDDT 179 Query: 181 KLFENLVYFLERVIPVCEECDVKLAIHPDDPPWSIFGLPRIITNKENIERMLKAVDSPYN 240 +L ENL YFL VIPVCEE VK+AIHPDDPP+SIFGLPR++ N ++ + VDSP N Sbjct: 180 RLRENLFYFLREVIPVCEEVGVKMAIHPDDPPYSIFGLPRVVKNHADLALICDTVDSPAN 239 Query: 241 GITFCMGSLGANPENNIPEMIRYFGKMGRIHFAHVRNLKFTGEKSFYETAHPSFCGSHDL 300 GIT C GS+ +P+NN+ E++ F + R+HFAHVRN+K +K FYE+AHPS GS D+ Sbjct: 240 GITLCTGSIAEDPDNNVYEILAEFTRRKRLHFAHVRNIKLIKDKDFYESAHPSAYGSLDM 299 Query: 301 FEVMKAFHDIGYEGYIRPDHGRLIWGEKARPGYGLYDRALGATYILGLWEAIDKMK 356 + +M+A HD G++GYIRPDHGR IWGE RPGYGLYDRALG TY++GLWEA++K K Sbjct: 300 YRIMQALHDNGFDGYIRPDHGRFIWGETGRPGYGLYDRALGVTYLMGLWEALEKQK 355 Lambda K H 0.322 0.142 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 355 Length adjustment: 29 Effective length of query: 331 Effective length of database: 326 Effective search space: 107906 Effective search space used: 107906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BWI76_RS23640 BWI76_RS23640 (mannonate dehydratase)
to HMM TIGR00695 (uxuA: mannonate dehydratase (EC 4.2.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00695.hmm # target sequence database: /tmp/gapView.27065.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00695 [M=394] Accession: TIGR00695 Description: uxuA: mannonate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-125 403.8 0.0 7.3e-68 215.4 0.0 2.0 2 lcl|FitnessBrowser__Koxy:BWI76_RS23640 BWI76_RS23640 mannonate dehydrat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS23640 BWI76_RS23640 mannonate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 187.0 0.1 3.2e-59 3.2e-59 1 134 [. 1 136 [. 1 151 [. 0.95 2 ! 215.4 0.0 7.3e-68 7.3e-68 180 389 .. 154 353 .. 137 355 .] 0.92 Alignments for each domain: == domain 1 score: 187.0 bits; conditional E-value: 3.2e-59 TIGR00695 1 meqtfrwyGr.ndpvsledvrqa.GakGivtalhhipnGevweveeikkrkeeiedaGlsasvvesvpvhe 69 m++t+rw+G+ +d + le++rq+ G++G+v al+++ Gevw ve+ik+ e+ + aGl+++v+esv++h+ lcl|FitnessBrowser__Koxy:BWI76_RS23640 1 MQMTMRWFGPqEDKIPLEYIRQVpGVEGVVGALYDVAPGEVWPVEKIKALIEQAHAAGLKMEVIESVNIHD 71 89********99*********************************************************** PP TIGR00695 70 eiklqteeyekyienykqtlrnlaqcGikvvcynfmpvldwtrtdlayeledGskalrfdkikva 134 +ik+++ e+++yi+nykqt+rnla++G+kv+cynfmpv+dw +td++y+l+dGs ++ f+k ++ lcl|FitnessBrowser__Koxy:BWI76_RS23640 72 DIKIGSAERDRYIDNYKQTIRNLAGFGVKVICYNFMPVFDWMKTDMNYVLPDGSLTMAFEKRGID 136 ************************************************************97764 PP == domain 2 score: 215.4 bits; conditional E-value: 7.3e-68 TIGR00695 180 glpGaeegekldrikelleaykdideeklrenlafflkeilpvaeevGvkmaihpddpprpilGlprivst 250 +lpG+e+ e+l++++el+++y+d+d+ +lrenl +fl+e++pv eevGvkmaihpddpp+ i+Glpr+v lcl|FitnessBrowser__Koxy:BWI76_RS23640 154 ALPGWEP-ERLAKVQELFARYRDVDDTRLRENLFYFLREVIPVCEEVGVKMAIHPDDPPYSIFGLPRVVKN 223 69*****.*************************************************************** PP TIGR00695 251 iedmkklveisdspangitlctGsyGvradndlvelakqfa..driyfahlrsvkreenpktfheaahlek 319 +d+ + +++dspangitlctGs+ +dn++ e+ +f+ +r++fah+r++k ++ +f+e+ah + lcl|FitnessBrowser__Koxy:BWI76_RS23640 224 HADLALICDTVDSPANGITLCTGSIAEDPDNNVYEILAEFTrrKRLHFAHVRNIKLIKDK-DFYESAHPSA 293 ****************************************8334689********99887.*******987 PP TIGR00695 320 dvdlyevvkavleeehrrkaeGkedlipvrpdhGrqllddlkkktnpGysaigrlkGlaelrGlelalkk 389 ++l + +++ +h + +G + +rpdhGr +++ + +pGy++++r++G+++l Gl+ al+k lcl|FitnessBrowser__Koxy:BWI76_RS23640 294 YGSLD--MYRIMQALHDNGFDG----Y-IRPDHGRFIWG---ETGRPGYGLYDRALGVTYLMGLWEALEK 353 76665..557888889999999....6.8**********...99************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 3.87 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory