Align mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate BWI76_RS27935 BWI76_RS27935 galactonate dehydratase
Query= BRENDA::A0A0H3C643 (403 letters) >FitnessBrowser__Koxy:BWI76_RS27935 Length = 382 Score = 178 bits (452), Expect = 2e-49 Identities = 122/394 (30%), Positives = 188/394 (47%), Gaps = 40/394 (10%) Query: 21 LKITTEDGITGVGDATLNGRELSVVSFLQDHMVPSLIGRDAHQIEDIWQFFYRGSYWRGG 80 LKI T++G+ G G+ + GR +V + + + + LIG+D +I D+WQ YR ++RGG Sbjct: 18 LKIDTDEGVVGWGEPVIEGRARTVEAAVHE-LGDYLIGQDPARINDLWQVMYRAGFYRGG 76 Query: 81 PVAMTALAAVDMALWDIKGKVAGLPVYQLLGGACRTGVTVYGHANGETIEDTIAEAVKYK 140 P+ M+A+A +D ALWDIKGKV PV+QL+GG R + Y G+ + I K + Sbjct: 77 PILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWVGGDRPAEVIDGIKKLR 136 Query: 141 AMGYKAIRLQTGVPGLASTYGVSKDKMFYEPADNDLPTENIWSTAKYLNSVPKLFERARE 200 +G+ +L N + ++ +++ + RE Sbjct: 137 GIGFDTFKL------------------------NGCEELGLIDNSRAVDAAVNTVAQIRE 172 Query: 201 VLGWDVHLLHDVHHRLTPIEAARLGKDLEPYRLFWLEDSVPAENQAGFRLIRQHTTTPLA 260 G ++ D H R++ A L K+LE YR ++E+ V AE + + T+ P+A Sbjct: 173 AFGNEIEFGLDFHGRVSAPMAKVLIKELEQYRPLFIEEPVLAEQAEYYPRLAAQTSIPIA 232 Query: 261 VGEIFAHVWDAKQLIEEQLIDYLRATVLHAGGITNLKKIAAFADLHHVKTGCHGATDLSP 320 GE ++ K+++E + L+ + HAGGIT KIA A+ + V H L P Sbjct: 233 AGERMFSRFEFKRVLEAGGLAILQPDLSHAGGITECYKIAGMAEAYDVALAPH--CPLGP 290 Query: 321 VTMAAALHFDMSITNFGLQE------YMRHTPETDAV-FPHAYTFSDGMLHPGDKPGLGV 373 + +AA LH D N QE Y + D V + G P KPGLGV Sbjct: 291 IALAACLHVDFVSYNAVFQEQSMGIHYNKGAELLDFVKNKEDFNMEGGFFKPLMKPGLGV 350 Query: 374 DIDE----DLAAKHPYKRAYLPVNRLEDGTMFNW 403 +IDE +L+ P R P+ RLEDG + W Sbjct: 351 EIDEARVMELSQNAPDWRN--PLWRLEDGVVAEW 382 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 382 Length adjustment: 31 Effective length of query: 372 Effective length of database: 351 Effective search space: 130572 Effective search space used: 130572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory