Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate BWI76_RS03740 BWI76_RS03740 hypothetical protein
Query= BRENDA::Q8VUG0 (301 letters) >FitnessBrowser__Koxy:BWI76_RS03740 Length = 255 Score = 171 bits (432), Expect = 2e-47 Identities = 97/254 (38%), Positives = 147/254 (57%), Gaps = 8/254 (3%) Query: 38 ITCGIDVGSVSSQAVLVCDGELYGYNSMRTGNNSPDSAKNALQGIMDKIGMKLEDINYVV 97 +T GID GS +++ +L+ DG + R +P +A+ + + L + ++ Sbjct: 3 VTVGIDSGSTATKGILLADGVI----QRRFLCPTPFRPADAIVEAWETLRAGLSERPFLT 58 Query: 98 GTGYGRVNVPFAHKAITEIACHARGANYMGGNKVRTILDMGGQDCKAIHCDDKGKVTNFL 157 TGYGR V FA K +TEI+CH GA + + RT++D+GGQD K I DD G +T+FL Sbjct: 59 LTGYGRQLVDFADKQVTEISCHGLGARLLAP-QTRTVIDIGGQDSKVIQLDDAGNLTDFL 117 Query: 158 MNDKCAAGTGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEALGLLKAG 217 MNDKCAAGTGR +EVIS + + +L S EP A++S+C VFA+SE + L AG Sbjct: 118 MNDKCAAGTGRFLEVISRTLGASVDQLD--SITEGVEPHAITSMCTVFAESEVISLRSAG 175 Query: 218 YTKNMVIAAYCQAMAERVVSLLERIGVEEGFFITGGIAKNPGVVKRIERLLGIKQLETKI 277 ++A AMA R + + R+ + TGG+++ +R+E +G+ ++T Sbjct: 176 VPPEAILAGVINAMARRSANFIGRLSAQGPLLFTGGVSRCAAFARRLEEHVGM-AVQTHP 234 Query: 278 DSQIAGALGAALFG 291 D+Q AGA+GAAL G Sbjct: 235 DAQFAGAIGAALIG 248 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 255 Length adjustment: 25 Effective length of query: 276 Effective length of database: 230 Effective search space: 63480 Effective search space used: 63480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory