GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ARO8 in Klebsiella michiganensis M5al

Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate BWI76_RS01925 BWI76_RS01925 aromatic amino acid aminotransferase

Query= CharProtDB::CH_004054
         (397 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS01925 BWI76_RS01925 aromatic amino
           acid aminotransferase
          Length = 397

 Score =  679 bits (1752), Expect = 0.0
 Identities = 339/397 (85%), Positives = 360/397 (90%)

Query: 1   MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60
           MFQKVDAYAGDPIL+LMERFK+DPRSDKVNLSIGLYYNEDGIIPQLQ+VA AEARLNAQP
Sbjct: 1   MFQKVDAYAGDPILSLMERFKDDPRSDKVNLSIGLYYNEDGIIPQLQSVAAAEARLNAQP 60

Query: 61  HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120
           HGAS+YLPMEGLN YRHAIAPLLFGADH VL Q RVA+IQTLGGSGALKVGADFLKRYFP
Sbjct: 61  HGASVYLPMEGLNTYRHAIAPLLFGADHQVLAQNRVASIQTLGGSGALKVGADFLKRYFP 120

Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180
            S VWVSDPTWENH+AIF GAGFEVSTYPW+DE TNGVRF   L  L +L  R IVLLHP
Sbjct: 121 GSRVWVSDPTWENHIAIFEGAGFEVSTYPWFDEKTNGVRFAAFLEKLNSLAERDIVLLHP 180

Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240
           CCHNPTGADL+N QWD V+E+LKAR LIPFLDIAYQGFGAGMEEDAYAIRAIA+AG+P L
Sbjct: 181 CCHNPTGADLSNAQWDQVVEVLKARNLIPFLDIAYQGFGAGMEEDAYAIRAIANAGMPML 240

Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300
           VSNSFSKIFSLYGERVGGLS++CEDAE A RVLGQLKATVRRNYSSPPNFGAQVVAAVL+
Sbjct: 241 VSNSFSKIFSLYGERVGGLSIVCEDAETAIRVLGQLKATVRRNYSSPPNFGAQVVAAVLS 300

Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360
           D  LKASWLAEVE MRTRILAMRQELV VL   +P  NFDYLL QRGMFSYTG S AQVD
Sbjct: 301 DSELKASWLAEVEGMRTRILAMRQELVNVLKETVPGGNFDYLLKQRGMFSYTGFSLAQVD 360

Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397
           RLR+EFGVYLIASGRMCVAGLN+ NVQRVA+AFAAV+
Sbjct: 361 RLRDEFGVYLIASGRMCVAGLNSRNVQRVAQAFAAVI 397


Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 585
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 397
Length adjustment: 31
Effective length of query: 366
Effective length of database: 366
Effective search space:   133956
Effective search space used:   133956
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory