GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ARO8 in Klebsiella michiganensis M5al

Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate BWI76_RS10245 BWI76_RS10245 aspartate aminotransferase

Query= SwissProt::P58350
         (410 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS10245 BWI76_RS10245 aspartate
           aminotransferase
          Length = 402

 Score =  392 bits (1008), Expect = e-114
 Identities = 196/397 (49%), Positives = 267/397 (67%)

Query: 13  QPASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGET 72
           Q A R+ S+  S    I  +   ++  GK VI LG GE DF TP H+  A  +AI   +T
Sbjct: 5   QIARRMRSVRPSPTAAISDQVRVLEAAGKQVINLGEGELDFATPPHISYAGIEAIVHHQT 64

Query: 73  KYTALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPT 132
           KYTA+ GT  LK AI  KF R+N L Y  +EI   +GAKQ++FNA +A+LD G +VIIP 
Sbjct: 65  KYTAVSGTAALKTAIAAKFARDNQLRYRPEEIIAGSGAKQLIFNAFLATLDAGQQVIIPA 124

Query: 133 PYWTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYS 192
           PYW SY D+V + +G+PV++ CD   G++LT E+L AA+TP TRW++LNSP NP+GA YS
Sbjct: 125 PYWVSYPDMVSLADGEPVIVPCDEQHGWKLTPEQLAAALTPSTRWLILNSPGNPTGAIYS 184

Query: 193 AADYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYA 252
             + R L +VL  +PHV ++ DD+YE + YD   F+T AQ  P L +RTLTVNGVSK++A
Sbjct: 185 EPELRALADVLADYPHVLVMADDIYEPLRYDNVPFITFAQAAPQLVSRTLTVNGVSKSHA 244

Query: 253 MTGWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRR 312
           MTGWR+GYAGGP+ LI AM ++QSQ+TS PSSISQAA++AALN   DF         +RR
Sbjct: 245 MTGWRLGYAGGPQWLIAAMQILQSQSTSNPSSISQAAAIAALNHSADFFDGWLHRLDKRR 304

Query: 313 DLVVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAV 372
             V+  + A +GL   +P+GAFY F+ C  ++G+VTP G+ ++ D+    +LLE   VAV
Sbjct: 305 QQVLGMIAATEGLSAGIPQGAFYVFANCQQLIGRVTPGGETLRDDSGLANWLLEHTQVAV 364

Query: 373 VPGSAFGLSPFFRISYATSEAELKEALERIAAACDRL 409
           + GSAFG+  + RI+YA  +  L +A +RIA AC +L
Sbjct: 365 LHGSAFGMPGYLRIAYAVEDGLLAQACQRIAGACAQL 401


Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 488
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 410
Length of database: 402
Length adjustment: 31
Effective length of query: 379
Effective length of database: 371
Effective search space:   140609
Effective search space used:   140609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory