Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate BWI76_RS14160 BWI76_RS14160 ABC transporter substrate-binding protein
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__Koxy:BWI76_RS14160 Length = 320 Score = 92.0 bits (227), Expect = 2e-23 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 1/135 (0%) Query: 147 AAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYAISVPL 206 A G A A+ V +++ GDG +++G EA+N A V + P +F+ +NN Y Sbjct: 123 AIGAALTAKTLKTGNVGVSFTGDGGSNQGLVFEAINMAVVLQLPAIFIFENNGYGEGTGH 182 Query: 207 AKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAVTYRIDA 266 R +A +AAG+G+P V +DG D VY A +A +RAR G GP++IEA +R Sbjct: 183 DYAVGGRDIAGRAAGFGLPAVTVDGTDFFAVYDATAEAVKRAREGGGPSVIEAKAFRWHG 242 Query: 267 HTNADDDTRYRPAGE 281 H D YR GE Sbjct: 243 HFEG-DPALYRAEGE 256 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 320 Length adjustment: 29 Effective length of query: 339 Effective length of database: 291 Effective search space: 98649 Effective search space used: 98649 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory