Align dihydromonapterin reductase (EC 1.5.1.50) (characterized)
to candidate BWI76_RS16230 BWI76_RS16230 dihydromonapterin reductase
Query= BRENDA::P0AFS3 (240 letters) >FitnessBrowser__Koxy:BWI76_RS16230 Length = 241 Score = 374 bits (959), Expect = e-108 Identities = 187/241 (77%), Positives = 209/241 (86%), Gaps = 1/241 (0%) Query: 1 MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFS 60 M QP PILITGGGRRIGLALA HF+ ++QPVI+SYRT YPAID L AGA C+ ADFS Sbjct: 1 MADIQPRPILITGGGRRIGLALARHFVARQQPVIISYRTWYPAIDALREAGAVCLHADFS 60 Query: 61 TNDGVMAFADEV-LKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHA 119 T++ ++AFA EV ++ GLRAI+HNAS WMAEKPG PL VLA MMQIHVN PYLLNHA Sbjct: 61 TDESILAFAAEVEAHASGGLRAIIHNASGWMAEKPGIPLTTVLASMMQIHVNAPYLLNHA 120 Query: 120 LERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSI 179 LE LLRGHGHAASDIIH TDYVVERGSDKHIAYAASKAALDNM+RSFARKLAPE+KVN+I Sbjct: 121 LESLLRGHGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMSRSFARKLAPEIKVNAI 180 Query: 180 APSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHL 239 APSLILFNE DDAEYR+QAL+KSLMK APGEKE+IDL +YL +S +VTGRSF +DGGRHL Sbjct: 181 APSLILFNEGDDAEYRRQALDKSLMKIAPGEKEIIDLTEYLFSSSYVTGRSFAVDGGRHL 240 Query: 240 R 240 R Sbjct: 241 R 241 Lambda K H 0.322 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory