Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate BWI76_RS19575 BWI76_RS19575 maleylacetoacetate isomerase
Query= reanno::MR1:200836 (216 letters) >FitnessBrowser__Koxy:BWI76_RS19575 Length = 214 Score = 198 bits (504), Expect = 6e-56 Identities = 107/218 (49%), Positives = 142/218 (65%), Gaps = 8/218 (3%) Query: 1 MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVD 60 M LY ++ SSA+YRVRIAL LKG+ + + V++ G+Q+ +Y LNP LVPTL+ D Sbjct: 1 MKLYSFFNSSASYRVRIALALKGIDYQSVGVNIRI--GQQNALEYRRLNPVGLVPTLITD 58 Query: 61 DEQDGDALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQY 120 G++L QSLAI ++LD YP+ LLP + R V + IAC+IHP+NN+RVL+Y Sbjct: 59 K---GESLGQSLAIADWLDRHYPQPLLLPQADSARMRVLEIVYAIACDIHPINNMRVLRY 115 Query: 121 LTQKLTVNEEAKSAWYHHWVATGFTALETQLVRH--SGRYCFGDKVTIADLCLVPQVYNA 178 L +L V+EE K WY HW+ GF+A+E QL+RH SG +C GD T+AD CLVPQ NA Sbjct: 116 LGDELKVSEEEKKRWYAHWIQQGFSAVE-QLLRHAKSGDFCVGDAPTLADCCLVPQWANA 174 Query: 179 QRFNVDLTPYPNIMRVWAECNQLPAFADAAPERQADAV 216 R DL+ YP V+ C +LPAF AAPE Q D + Sbjct: 175 LRMGCDLSHYPRCQAVYDACTRLPAFIAAAPENQQDKI 212 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 214 Length adjustment: 22 Effective length of query: 194 Effective length of database: 192 Effective search space: 37248 Effective search space used: 37248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate BWI76_RS19575 BWI76_RS19575 (maleylacetoacetate isomerase)
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.8910.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-93 298.4 0.0 1.6e-93 298.2 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS19575 BWI76_RS19575 maleylacetoacetate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS19575 BWI76_RS19575 maleylacetoacetate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 298.2 0.0 1.6e-93 1.6e-93 1 210 [. 2 211 .. 2 212 .. 0.99 Alignments for each domain: == domain 1 score: 298.2 bits; conditional E-value: 1.6e-93 TIGR01262 1 klYsyfrSsasyRvRiaLaLkgidyesvpvnLlkdGeqkkeefkalNPqelvPtLkidegevltqSlAiie 71 klYs+f+SsasyRvRiaLaLkgidy+sv vn++ G+q++ e+++lNP++lvPtL++d+ge+l qSlAi + lcl|FitnessBrowser__Koxy:BWI76_RS19575 2 KLYSFFNSSASYRVRIALALKGIDYQSVGVNIRI-GQQNALEYRRLNPVGLVPTLITDKGESLGQSLAIAD 71 69********************************.9*********************************** PP TIGR01262 72 yLeetypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiekGlaal 142 +L+++yp+p Llp+ ++r rv +++++iacdihP++N+rvl++l ++l+v+eeekk+w++hwi++G++a+ lcl|FitnessBrowser__Koxy:BWI76_RS19575 72 WLDRHYPQPLLLPQADSARMRVLEIVYAIACDIHPINNMRVLRYLGDELKVSEEEKKRWYAHWIQQGFSAV 142 *********************************************************************** PP TIGR01262 143 Eellk.ekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahpenqpdt 210 E+ll+ +k+g+fcvGd++tlad+cLvpq++nA r+++dl++yP+++++ +a+++lpaf +a+penq+d+ lcl|FitnessBrowser__Koxy:BWI76_RS19575 143 EQLLRhAKSGDFCVGDAPTLADCCLVPQWANALRMGCDLSHYPRCQAVYDACTRLPAFIAAAPENQQDK 211 *****899************************************************************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (214 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.39 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory