Align phenylacetyl-CoA 1,2-epoxidase (EC 1.14.13.149) (characterized)
to candidate BWI76_RS13100 BWI76_RS13100 phenylacetate-CoA oxygenase subunit PaaI
Query= BRENDA::P76079 (248 letters) >FitnessBrowser__Koxy:BWI76_RS13100 Length = 251 Score = 384 bits (987), Expect = e-112 Identities = 184/247 (74%), Positives = 212/247 (85%) Query: 2 NQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAG 61 N + AY LRLGDN LVL+QRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAG Sbjct: 5 NPVAAYALRLGDNGLVLAQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAG 64 Query: 62 EGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAA 121 GDEDTLAF R+ERQF NLLL EQPNGNFADT+ARQ+FID WHVAL+ RL+ SRD QLAA Sbjct: 65 SGDEDTLAFGRNERQFCNLLLAEQPNGNFADTLARQFFIDVWHVALYGRLVSSRDTQLAA 124 Query: 122 ISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSE 181 I+AKA+KE RYH RFSRGWLERLGNGT +S Q+MQ A++ LWRFT ELF AD ++I LS Sbjct: 125 IAAKALKEVRYHQRFSRGWLERLGNGTALSAQRMQDAVDNLWRFTGELFQADALEIELSA 184 Query: 182 EGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQR 241 +GIAVDPR L+A W+A V A +++A L +P+E +R GGK+GLH+EHLGP+LAEMQYLQR Sbjct: 185 QGIAVDPRELQAEWQATVRAALSDAGLQIPEEAPFRHGGKQGLHSEHLGPLLAEMQYLQR 244 Query: 242 VLPGQQW 248 PGQ+W Sbjct: 245 AYPGQRW 251 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 251 Length adjustment: 24 Effective length of query: 224 Effective length of database: 227 Effective search space: 50848 Effective search space used: 50848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory