GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Klebsiella michiganensis M5al

Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate BWI76_RS17800 BWI76_RS17800 long-chain-fatty-acid--CoA ligase

Query= BRENDA::A7KUK6
         (562 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS17800 BWI76_RS17800
           long-chain-fatty-acid--CoA ligase
          Length = 572

 Score =  213 bits (542), Expect = 2e-59
 Identities = 173/559 (30%), Positives = 262/559 (46%), Gaps = 51/559 (9%)

Query: 21  LFERKDRAYPDDKIIYQDADTQRHYTYKSLRDASLDFGKGLKALYEWRKGDVLALFTPNS 80
           LFE   R Y D        +     TY+ L + S  F   L+     +KGD +AL  PN 
Sbjct: 39  LFEHAVRRYADQPAFINMGEVM---TYRKLEERSRAFAAYLQEGLGLQKGDRVALMMPNL 95

Query: 81  IDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQASVLPVAREAAKKVGM 140
           +  PV ++G L AG  +   NP YT  EL  QL +S A  +V  ++      +   K  +
Sbjct: 96  LQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDSGAAAIVIVSNFAHTLEKVVDKTQV 155

Query: 141 PEDRIILIGDQRDP------DARVKH---------------FTSVRNISGATRYRKQKIT 179
               +  +GDQ  P      +  VK+               F S        +Y K +I 
Sbjct: 156 KHVILTRMGDQLSPAKGTVVNFVVKYIKRLVPKYHLPDAISFRSALQHGYRMQYIKPEIV 215

Query: 180 PAKDVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWNGGPDGKGDRVLAFL 239
           P +D+AFL Y+ GTTGV KG M++HRN++AN+ Q     G +L       GK + V+  L
Sbjct: 216 P-QDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNGTYGPLLH-----RGK-ELVVTAL 268

Query: 240 PFYHIYGLT--CLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSYIVPPVVLLLGKH 297
           P YHI+ LT  CL+   L  G +L++ +  DI      +  Y  +    V  +   L  +
Sbjct: 269 PLYHIFALTMNCLLFIEL-GGQNLLITNPRDIPGLVKELAKYPFTAMTGVNTLFNALLNN 327

Query: 298 PVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTTHSQRWEDWRE 357
               + D SSL +   G  P+ Q + E         + +GYGL+E +P   S    D   
Sbjct: 328 KEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLTECAPLV-SVNPHDIDY 386

Query: 358 AMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHENPEATKGCLS 417
             GS+G  +P+ +AK +       +  EV  GE GEL +KGP V LGY + P+AT   + 
Sbjct: 387 HSGSIGLPVPSTEAKLVD-----DDDNEVPPGEPGELCVKGPQVMLGYWQRPDATAEII- 440

Query: 418 EDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAIDDVAVIGIE 477
           +DGW  TGD+   D +G   I DR K++I   GF V P E+E  ++ +  + +VA +G+ 
Sbjct: 441 KDGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHAGVQEVAAVGVP 500

Query: 478 SETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLRGGVHFVDEIPKN 537
           S + G  V +  V    K   + T E      +I +   ++  +K +   V F DE+PK+
Sbjct: 501 SGSSGEAVKIFVV----KKDPTLTEE-----MLITFCRRQLTGYK-VPKHVEFRDELPKS 550

Query: 538 PSGKILRRILKQKFKGAAE 556
             GKILRR L+ + +   +
Sbjct: 551 NVGKILRRELRDEARAKVD 569


Lambda     K      H
   0.317    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 761
Number of extensions: 39
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 562
Length of database: 572
Length adjustment: 36
Effective length of query: 526
Effective length of database: 536
Effective search space:   281936
Effective search space used:   281936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory