GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Klebsiella michiganensis M5al

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate BWI76_RS10695 BWI76_RS10695 aldehyde dehydrogenase PuuC

Query= BRENDA::P05091
         (517 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS10695 BWI76_RS10695 aldehyde
           dehydrogenase PuuC
          Length = 495

 Score =  384 bits (987), Expect = e-111
 Identities = 202/474 (42%), Positives = 289/474 (60%), Gaps = 4/474 (0%)

Query: 38  QIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMD 97
           ++FIN E+  A     F T++P+  + + +VA G K DVD+AV+AAR  F  G  W +  
Sbjct: 21  RLFINGEYSAAADNSVFATIDPAAQQTLAEVARGKKADVDRAVQAARGVFDRGD-WSQAS 79

Query: 98  ASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYH 157
            + R  +L + ADL++  R  LA LETLD GKP   S   D+    + +R+YA   DK +
Sbjct: 80  PAQRKAVLTKFADLMDAHREELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVY 139

Query: 158 GKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLT 217
           G+  P  G+  +    EP+GV   ++PWNFPLL+  WKLGPALA+GN VV+K +E++PLT
Sbjct: 140 GEVAPTGGNELAMIVREPIGVIAAVVPWNFPLLLACWKLGPALASGNSVVLKPSEKSPLT 199

Query: 218 ALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSS 277
           AL +A L K+AG P GV N+V GFG  AG A+A H DV+ + FTGST   + +   AG S
Sbjct: 200 ALRLAGLAKQAGLPDGVFNVVSGFGHEAGQALALHPDVEVITFTGSTRTAKQLLKDAGDS 259

Query: 278 NLKRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFV 336
           N+KRV LE GGKS NI+ +D  D+  AV      +F+NQGQ C AG+R  ++E I D F+
Sbjct: 260 NMKRVWLEAGGKSANIVFADCPDLQKAVNATAGGIFYNQGQVCIAGTRLLLEESIADRFL 319

Query: 337 ERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGY 396
           +    +AK    GNP D  T  G  +D T    +  +I  G+     LL G         
Sbjct: 320 DLLKEQAKGWQPGNPLDPNTTMGMLIDNTHADSVHSFIRAGEAHSTLLLDGRKNPWPAA- 378

Query: 397 FIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKA 456
            + PT+F DV     +++EEIFGPV+ + +FK  E+ +  AN+S YGL AAV+T+DL +A
Sbjct: 379 -VGPTIFVDVDPASPLSQEEIFGPVLVVTRFKNEEQALALANDSRYGLGAAVWTRDLSRA 437

Query: 457 NYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTV 510
           + +S+ L+AG+V+VN Y+      PFGGYK SG+GR+   + L+ +TE+KT+ +
Sbjct: 438 HRVSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWI 491


Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 610
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 517
Length of database: 495
Length adjustment: 34
Effective length of query: 483
Effective length of database: 461
Effective search space:   222663
Effective search space used:   222663
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory