Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate BWI76_RS07275 BWI76_RS07275 ABC transporter
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__Koxy:BWI76_RS07275 Length = 368 Score = 231 bits (590), Expect = 3e-65 Identities = 151/361 (41%), Positives = 200/361 (55%), Gaps = 62/361 (17%) Query: 150 WLGPIAVVVALAFPFTPLADRQL--------LDIGILLLTYIMLGWGLNIVVGLAGLLDL 201 W G +V AL P+ QL +D +L Y+ML GLNIVVG GLLD+ Sbjct: 16 WSGMTLLVCALLV--APMVASQLGGNYWVRVIDFALL---YVMLALGLNIVVGYTGLLDM 70 Query: 202 GYVAFYAVGAYSYALLA--HYFGF--------------SFWVCLPLAGFLAAMSGVLLGF 245 G++AFYAVGAY ALLA H S+ V +PLA +AA G++LG Sbjct: 71 GFIAFYAVGAYLAALLASPHLLDVFPILNSWFPDGLHTSWLVIIPLAALVAAGCGIVLGA 130 Query: 246 PVLRLRGDYFAIVTLGFGEIIRIILINW---YQFTGGPNGISGIPRPSFFGIADFTRTPA 302 P L+LRGDY AIVTLGFGEIIRI++ N T G GISG+ + FG+ Sbjct: 131 PTLKLRGDYLAIVTLGFGEIIRILMRNLDRPVNITNGAKGISGVDSLNLFGLK------- 183 Query: 303 EGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFT-MRVRKLPLGRAWEALREDDIA 361 + + FG + L +L+Y +L+L +V +F +R++ +GRAW A+RED+ Sbjct: 184 --FSGVYHWFGFKVPAL----WLWYYLLMLVIVAIIFVCLRLQHSRIGRAWHAIREDEDV 237 Query: 362 CASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLGGMG 421 ++GIN N KL AFAI A FGG AG+ F QGF+SPESFT ES +LA+VVLGGMG Sbjct: 238 ARAMGINLRNYKLLAFAIGASFGGVAGALFGAFQGFVSPESFTLQESIAVLAMVVLGGMG 297 Query: 422 SQIGVVVAAFLVIGLPEAFRELAD----------------YRMLAFGMGMVLIMLWRPRG 465 GV++ A L+ LPE R A R L +G+ +VL+ML RP+G Sbjct: 298 HIPGVILGAVLLTALPELLRSQAAPVQQALFGEVLIDPEVLRQLFYGLALVLVMLLRPQG 357 Query: 466 L 466 + Sbjct: 358 I 358 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 368 Length adjustment: 32 Effective length of query: 473 Effective length of database: 336 Effective search space: 158928 Effective search space used: 158928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory