GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS00870 in Klebsiella michiganensis M5al

Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS07260 BWI76_RS07260 branched chain amino acid ABC transporter substrate-binding protein

Query= uniprot:A0A165KTD4
         (375 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS07260 BWI76_RS07260 branched chain
           amino acid ABC transporter substrate-binding protein
          Length = 385

 Score =  318 bits (816), Expect = 1e-91
 Identities = 162/366 (44%), Positives = 239/366 (65%), Gaps = 4/366 (1%)

Query: 9   VVAAIAAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGKK 68
           +++  A++A  ++A E V+ IG   P++G  A  GKD ENGA++AI+++N Q  TIGGK 
Sbjct: 14  LLSGFASSAAWSAASETVI-IGLAGPLTGPSARIGKDLENGAQLAIDDINKQHPTIGGKA 72

Query: 69  IKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAA 128
           + F+L +EDD +DP+   A AQ+L D+ VAGVVGH N+GT+IPA++VY+D GI  V   A
Sbjct: 73  VTFKLQSEDDQSDPRTAVAVAQRLVDSGVAGVVGHWNTGTSIPAARVYHDAGIAQVAPVA 132

Query: 129 TNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKKT 188
           T    TK G+ T+FR++ +D+  G     YAV TLK K +A+IDDRTA+GQG+AD F K+
Sbjct: 133 TGHAYTKQGFDTSFRVMGHDDDGGQFAGQYAVQTLKAKRIAVIDDRTAFGQGLADEFIKS 192

Query: 189 ATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGNV 248
              +G+ +VD Q+  DK  DF A+LTAI++KN D IF+GG+D Q  P+ R+++QLGM N 
Sbjct: 193 LEVQGINIVDRQYVDDKTVDFSAVLTAIRSKNADLIFFGGVDSQAAPLARRIKQLGM-NA 251

Query: 249 KYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQFQVYS 308
              G  G  +    +LA   K    V+  E G  + +MPGG A++  Y ++Y    ++++
Sbjct: 252 TLMGAGGFVSQTFLQLA--QKEGDGVVALEPGLPVERMPGGKAFEQAYQSRYHTHIELHA 309

Query: 309 PYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNPAITLYVYK 368
           P+ YDAT ++V AM++A+SVDP  Y P L   ++ GVT  IAF+  G +K+P  T+Y   
Sbjct: 310 PFAYDATRVLVAAMEKADSVDPADYLPALRAINYAGVTGQIAFDKEGNLKSPTFTVYKVV 369

Query: 369 DGKKTP 374
           +GK  P
Sbjct: 370 EGKWQP 375


Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 372
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 375
Length of database: 385
Length adjustment: 30
Effective length of query: 345
Effective length of database: 355
Effective search space:   122475
Effective search space used:   122475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory