Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 234 bits (597), Expect = 2e-66 Identities = 133/308 (43%), Positives = 194/308 (62%), Gaps = 16/308 (5%) Query: 3 IFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAP 62 IF+QQ++NG+ LG MYALIA+GYTMVYGVL LINFAH D++MVGA L L + Sbjct: 5 IFLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSI----- 59 Query: 63 GLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMI 122 GLP +A+ + +C + +LI+R+AYRPLR A +++ LITAIGVS L+ L ++ Sbjct: 60 GLP----FGVAVFLTLALCGLFGMLIDRVAYRPLRQASKISMLITAIGVSFFLENLFNVL 115 Query: 123 WGRSPLPFPQVMPSDPVHIAGALISPTQIMLLAL-AVLAMVGLVLIVEKTKMGRAMRATA 181 +G S F + G +I ++ L VL ++ ++ ++ +T+ G A+RA A Sbjct: 116 FGGSSRFFSAPDFFNNTRAFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVA 175 Query: 182 ENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVL 241 + LMG+DAN++I + FA+G+ LAA+ GV ++ +Y T MG + GLKAF+AAVL Sbjct: 176 FDVNTVRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVL 235 Query: 242 GGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIM 301 GGIG++ GA+LGG +LG E + +L G Y+D FAF+ LI+VL RP GIM Sbjct: 236 GGIGSVTGAVLGGFILGFTEVVAVALFPELGG------YKDAFAFMFLILVLLFRPVGIM 289 Query: 302 GERVADRA 309 G+ +R+ Sbjct: 290 GDERLERS 297 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 299 Length adjustment: 27 Effective length of query: 282 Effective length of database: 272 Effective search space: 76704 Effective search space used: 76704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory