Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate BWI76_RS15320 BWI76_RS15320 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__Koxy:BWI76_RS15320 Length = 232 Score = 160 bits (404), Expect = 3e-44 Identities = 89/219 (40%), Positives = 131/219 (59%), Gaps = 2/219 (0%) Query: 9 LLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEY 68 +LQV L YGG ++GVDF R+GE+ L+G NG GKTT +K + G + G + + Sbjct: 1 MLQVNQLHQYYGGSHILRGVDFAARQGEITCLLGRNGVGKTTLLKCLMGLIPARSGEVLW 60 Query: 69 LGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFTI 128 K+I + V+ G+ VP+GR +F R+T+ ENL MG R A E+++ + Sbjct: 61 QEKNITHRKPHQRVQSGIAYVPQGREIFPRLTVEENLLMG-LSRFPARDARAVPEEIYQL 119 Query: 129 FPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVRDV 188 FP L+ K + G +SGG+QQ LA+GRAL S+P++L+LDEP+ G+ P ++ +I EV+R + Sbjct: 120 FPVLKTMKQRRGGDLSGGQQQQLAIGRALASRPQLLILDEPTEGIQPSVIKEIGEVIRQL 179 Query: 189 YALG-VTIVLVEQNASRALAIADRGYVMESGLITMTGPG 226 G + I+LVEQ A +ADR VM G I G G Sbjct: 180 ANRGDMAILLVEQFYDFAAGLADRYLVMSRGAIIQQGNG 218 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 232 Length adjustment: 23 Effective length of query: 219 Effective length of database: 209 Effective search space: 45771 Effective search space used: 45771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory