Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate BWI76_RS26330 BWI76_RS26330 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__Koxy:BWI76_RS26330 Length = 233 Score = 219 bits (558), Expect = 4e-62 Identities = 113/235 (48%), Positives = 165/235 (70%), Gaps = 3/235 (1%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 +L +S YG IQA+ + L +N+GE+VTLIGANGAGKTT L + G AS G + Sbjct: 1 MLSFDNVSAHYGKIQALHNVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRAS--SGRV 58 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWF 124 + G+ + ++ +++++ +A+VPEGR VF+RM+++ENL MG + +D + Q I + Sbjct: 59 VFDGKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAD-RDQFQTRIKWVY 117 Query: 125 AVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIR 184 +FPRL ER Q AGT+SGGEQQMLA+ RALMS P+LLLLDEPS+GL+PI++++IF+ I Sbjct: 118 ELFPRLHERRVQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPIIIQQIFDTIE 177 Query: 185 NVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLG 239 + QG+TI LVEQNA AL+ A RGYV+E+G + ++ +L + V++AYLG Sbjct: 178 QLREQGMTIFLVEQNANQALKLADRGYVLENGHVVLEDTGDALLANEAVRSAYLG 232 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 233 Length adjustment: 23 Effective length of query: 218 Effective length of database: 210 Effective search space: 45780 Effective search space used: 45780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory