Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate BWI76_RS07580 BWI76_RS07580 polar amino acid ABC transporter inner membrane subunit
Query= TCDB::Q52814 (384 letters) >FitnessBrowser__Koxy:BWI76_RS07580 Length = 213 Score = 105 bits (263), Expect = 9e-28 Identities = 64/205 (31%), Positives = 111/205 (54%), Gaps = 12/205 (5%) Query: 174 GLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVM 233 G TL +S + IA + +G+L+AL R R+PVI L V +I + R PL+T++ + Sbjct: 12 GAWTTLWISAIAIAFGVAIGLLIALVRMLRIPVIDQLLVVYISLARATPLVTLVLFLFLS 71 Query: 234 LPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTR 293 LP G N+DK + A++ +++ TSA+ AE+ R + P+ Q E A+S+G+ W R Sbjct: 72 LPT---VGINLDKNVAAIVALTLNTSAFNAEIWRNAFRTFPREQREAAESVGMRRWAYFR 128 Query: 294 LIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVT--PIT 351 I++PQ +P++VN K + + +IG+ DL + N S+VT P++ Sbjct: 129 YIMLPQMWIESLPALVNEMSFLIKGSPAIAVIGVVDLTRV-------TNRISSVTYEPLS 181 Query: 352 GLIFAGFIFWLFCFGMSRYSGFMER 376 ++ AG ++ + + + G ER Sbjct: 182 PILAAGLLYVVIIGLLLKLQGMAER 206 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 213 Length adjustment: 26 Effective length of query: 358 Effective length of database: 187 Effective search space: 66946 Effective search space used: 66946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory