Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate BWI76_RS07615 BWI76_RS07615 betaine-aldehyde dehydrogenase
Query= BRENDA::Q88RC0 (480 letters) >FitnessBrowser__Koxy:BWI76_RS07615 Length = 490 Score = 313 bits (801), Expect = 1e-89 Identities = 174/483 (36%), Positives = 274/483 (56%), Gaps = 9/483 (1%) Query: 6 AQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWR 65 +++ QQ YI+G ++ A +G+T + NPA GEV+ TV G + RA+++A K W Sbjct: 2 SRMAEQQLYIDGGYVSATSGKTFETINPANGEVLATVQAAGREDVDRAVKSAQKGQKIWA 61 Query: 66 ALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPLAE-AKGEIAYAASFIEWFAEEAK 124 A++A ERS LR+ +++ D+LARL T + GKPL+E A +I A +E++A Sbjct: 62 AMSAMERSRILRKAVDILRARNDELARLETLDTGKPLSETAAVDIVTGADVLEYYAGLIP 121 Query: 125 RIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQ 184 + G IP + + ++P+GV A I WN+P + K+ PALAAG M+ KP+ Sbjct: 122 ALEGSQIP-LRDSSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEV 180 Query: 185 TPYSALALVELAHRAGIPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLM-E 243 TP +AL L E+ AG+PAGV +V+ G+ E G LT + + K+SFTG G+++M Sbjct: 181 TPLTALKLAEIYREAGLPAGVFNVLPGTGAETGQYLTEHPDIAKISFTGGVASGKKVMAN 240 Query: 244 ECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVYD 303 A +K+V++ELGG +P IV +DA LD A + A+++ + ++GQ C R++V + Sbjct: 241 AAASSLKEVTMELGGKSPLIVCEDASLDLAADIAMMANFYSSGQVCTNGTRVFVPTRLKA 300 Query: 304 AFAEKLAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSGGKLIEG 363 AF EK+ A VA+++ G+ E T GPL+ V +IE +GA++L GG+ ++G Sbjct: 301 AFEEKILARVARIRPGDLFAESTNFGPLVSFPHRDNVLRYIETGKQEGARLLCGGEALKG 360 Query: 364 NFFE------PTILVDVPKTAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFY 417 F+ PT+ D + +EE FGP+ + + DE E + +N TE+GLA+ Sbjct: 361 EGFDRGAWVAPTVFTDCDDQMTIVREEIFGPVMSILSYDDEEEALRRANATEYGLAAGVV 420 Query: 418 ARDMSRVFRVAEALEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLC 477 D++R R+ LE G+ INT S P GG K SG+GRE + Y +IK + Sbjct: 421 TPDLNRAHRLIHRLEAGICWINTWGESPAEMPVGGYKHSGIGRENGVQTLHSYTQIKSIQ 480 Query: 478 ISV 480 + + Sbjct: 481 VEM 483 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 490 Length adjustment: 34 Effective length of query: 446 Effective length of database: 456 Effective search space: 203376 Effective search space used: 203376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory