Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate BWI76_RS17620 BWI76_RS17620 ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Koxy:BWI76_RS17620 Length = 362 Score = 176 bits (447), Expect = 5e-49 Identities = 99/224 (44%), Positives = 147/224 (65%), Gaps = 6/224 (2%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 + +SL I +G++ +G SG GK+T++R IN+L P +G+V G + L A + Sbjct: 19 IRGLSLVINSGELCTFVGPSGCGKTTILRMINQLDVPDAGDVYVQG---VKLAAADIIQV 75 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLS-GYDAKFP 161 R R++ V QS AL PHRTV QN+ R+ G SK + + +D + L ++P Sbjct: 76 R-RQIGFVMQSAALFPHRTVAQNIATVPRLLGWSKKHIQARIDELVDLMSLDRNVLPRYP 134 Query: 162 HQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFIT 221 HQLSGG + RV +ARALAAD V+LMDE F+A+DP++R +QD+LL LQ+ L KTIV +T Sbjct: 135 HQLSGGQQGRVAIARALAADPPVLLMDEPFAAIDPVVRERLQDELLLLQQRLRKTIVLVT 194 Query: 222 HDLDEALRIGSEIAILRD-GQVVQVGTPNDILDNPANDYVARFV 264 HD++EA+R+G IAI ++ G++ Q TP+ IL +PA+D+V RF+ Sbjct: 195 HDINEAIRLGDRIAIFQEGGELAQFATPDHILSHPASDFVRRFI 238 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 362 Length adjustment: 27 Effective length of query: 248 Effective length of database: 335 Effective search space: 83080 Effective search space used: 83080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory