Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate BWI76_RS11255 BWI76_RS11255 putrescine/spermidine ABC transporter ATP-binding protein
Query= TCDB::Q9RQ06 (407 letters) >FitnessBrowser__Koxy:BWI76_RS11255 Length = 378 Score = 187 bits (476), Expect = 3e-52 Identities = 102/241 (42%), Positives = 144/241 (59%), Gaps = 7/241 (2%) Query: 39 GATVGVYDTNFEINEGEIFVIMGLSGSGKSTLLRLLNRLIEPTSGKIFIDDQDVATLNKE 98 G TV + D N IN GE ++G SG GK+T+LRL+ L SG+I ++D D+ + E Sbjct: 29 GKTV-ISDLNLTINNGEFLTLLGPSGCGKTTVLRLIAGLESVDSGRIHLEDHDITHIPAE 87 Query: 99 DLLQVRRKSMSMVFQNFGLFPHRTILENTEYGLEVQNVPKEERRKRAEKALDNANLLDFK 158 + + ++ VFQ++ LFPH T+ EN +GL +Q P E R AL L F Sbjct: 88 N------RHVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVHDALRMVQLDAFA 141 Query: 159 DQYPKQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRREMQDELLELQAKFQKTI 218 + P QLSGG QQRV +ARA+ N P +LL+DE+ SALD +R++MQ+EL LQ K T Sbjct: 142 QRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGITF 201 Query: 219 IFVSHDLNEALRIGDRIAIMKDGKIMQIGTGEEILTNPANDYVKTFVEDVDRAKVITAEN 278 +FV+HD EAL + DRI +M++GKI Q GT EI P N +V +F+ +++ E Sbjct: 202 VFVTHDQEEALTMSDRIVVMREGKIEQDGTPREIYEEPKNLFVASFIGEINIFDATVIER 261 Query: 279 I 279 I Sbjct: 262 I 262 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 378 Length adjustment: 31 Effective length of query: 376 Effective length of database: 347 Effective search space: 130472 Effective search space used: 130472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory