GapMind for catabolism of small carbon sources

 

Aligments for a candidate for opuBB in Klebsiella michiganensis M5al

Align BusAB aka OPUABC, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate BWI76_RS22070 BWI76_RS22070 proline/betaine ABC transporter permease ProW

Query= TCDB::Q9RQ05
         (573 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS22070 BWI76_RS22070
           proline/betaine ABC transporter permease ProW
          Length = 354

 Score =  239 bits (610), Expect = 1e-67
 Identities = 134/289 (46%), Positives = 179/289 (61%), Gaps = 9/289 (3%)

Query: 9   IPLANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVVTILAILVS 68
           IPL +WV+   DW+   F   F  I+     +++     L  +P  + I + +++A  +S
Sbjct: 62  IPLDSWVTHGIDWVVMHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAIIIFSLIAWQIS 121

Query: 69  GKKFAFPLFAFIGLCLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMAKSELVAKI 128
                      I L  I   G WS  M T+ LVL + L  ++IG+PLGIW+A+S   AKI
Sbjct: 122 S--VGMGAATLISLIAIGAIGAWSQAMVTLALVLTALLFCMLIGLPLGIWLARSPRAAKI 179

Query: 129 VQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMTNLGIRQVSTELVE 188
           ++P+LD MQT P FVYL+P V  FGIG VPGV  ++IFALPP VR+T LGI QV  +L+E
Sbjct: 180 IRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPADLIE 239

Query: 189 AADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLGRGVLAAVQ 248
           A+ SFG++ RQ LFK++ PLA  TIMAGVNQT+MLALSMVVIASMI   GLG+ VL  + 
Sbjct: 240 ASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIG 299

Query: 249 SADIGKGFVSGISLVILAIIIDRFTQKLNVSPLEKQGNPKLKKWKRWIA 297
             D+G   V G+ +VILAII+DR TQ +       +GN      +RW A
Sbjct: 300 RLDMGLATVGGVGIVILAIILDRLTQAVG-RDSRSRGN------RRWYA 341


Lambda     K      H
   0.319    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 519
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 573
Length of database: 354
Length adjustment: 33
Effective length of query: 540
Effective length of database: 321
Effective search space:   173340
Effective search space used:   173340
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory