GapMind for catabolism of small carbon sources

 

Aligments for a candidate for proY in Klebsiella michiganensis M5al

Align Proline-specific permease (ProY) (characterized)
to candidate BWI76_RS08745 BWI76_RS08745 proline-specific permease

Query= TCDB::P37460
         (456 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS08745 BWI76_RS08745
           proline-specific permease
          Length = 459

 Score =  565 bits (1456), Expect = e-165
 Identities = 275/456 (60%), Positives = 352/456 (77%), Gaps = 2/456 (0%)

Query: 1   MESNNK--LKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGVAAYII 58
           M+  NK  L RGL+ RHIRF+ALGSAIGTGLFYGSA AIK AGP+VLLAY+IGG A +I+
Sbjct: 1   MQQQNKPHLLRGLNARHIRFIALGSAIGTGLFYGSASAIKAAGPAVLLAYLIGGAAVFIV 60

Query: 59  MRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWF 118
           MRALGEM+V NP + SFS YA++ LGPLAG+ITGWTY FE++IVA+ADVTAFGIYMG+W+
Sbjct: 61  MRALGEMAVRNPVSGSFSSYARQYLGPLAGFITGWTYTFEMVIVALADVTAFGIYMGLWY 120

Query: 119 PAVPHWIWVLSVVLIICAINLMSVKVFGELEFWFSFFKVATIIIMIVAGIGIIVWGIGNG 178
           P VP WIWVLS++  I A+NL SV+VFGE+EFW S  KV  II MIVAG  II +G GN 
Sbjct: 121 PDVPRWIWVLSIIFFIGAMNLCSVRVFGEMEFWLSLIKVVAIIAMIVAGGSIIFFGFGNA 180

Query: 179 GQPTGIHNLWSNGGFFSNGWLGMIMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINS 238
              TG+ NLWS+GGF  NGW G+I SL +VMFA+GG+EIIG+TA EAK+P+K IP+AIN+
Sbjct: 181 FPATGLENLWSHGGFAPNGWEGIIASLGIVMFAFGGVEIIGVTAAEAKNPQKVIPQAINT 240

Query: 239 VPMRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAI 298
           +P+RI++FYV TL ++M+I+PWN  G  GSPFVL F  +GI  AA+ILN +V++AS+SAI
Sbjct: 241 IPLRIVLFYVCTLAILMAIFPWNSFGERGSPFVLIFDGLGIPAAATILNIIVISASISAI 300

Query: 299 NSDVFGVGRMLHGMAEQGSAPKVFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPENVFL 358
           NSD+FG GRM++GMA++G APK F + +  G+PW+TV+VM +ALL AV LNY+MPE VF+
Sbjct: 301 NSDIFGAGRMMYGMAKEGLAPKSFQRIASNGVPWMTVVVMGVALLAAVVLNYLMPEQVFV 360

Query: 359 VIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIAL 418
           +IASLA FATVWVW+MILL+  A RR L  EE   + F VP   V  +  L+F+  +IA+
Sbjct: 361 LIASLAAFATVWVWVMILLAHFAMRRGLSAEERGNIAFPVPLWPVAPLLTLLFMGLVIAV 420

Query: 419 IGYHPDTRISLYVGFAWIVLLLIGWIFKRRRDRQLA 454
           +G   +TRI+L  G  W+ LL   W  + R++  LA
Sbjct: 421 LGMVEETRIALIAGLVWLGLLTAVWFARVRKNAVLA 456


Lambda     K      H
   0.329    0.143    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 701
Number of extensions: 30
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 456
Length of database: 459
Length adjustment: 33
Effective length of query: 423
Effective length of database: 426
Effective search space:   180198
Effective search space used:   180198
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory