GapMind for catabolism of small carbon sources

 

Aligments for a candidate for putA in Klebsiella michiganensis M5al

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate BWI76_RS12820 BWI76_RS12820 NAD-dependent phenylacetaldehyde dehydrogenase

Query= BRENDA::Q9RW56
         (523 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS12820 BWI76_RS12820 NAD-dependent
           phenylacetaldehyde dehydrogenase
          Length = 499

 Score =  238 bits (608), Expect = 3e-67
 Identities = 169/516 (32%), Positives = 262/516 (50%), Gaps = 38/516 (7%)

Query: 25  QAALAKVRKELLGKHYPLIIDG--QEVDTEGKIQSINPCDTSEVVGTTAKATIGDAENAL 82
           Q AL    ++ L + + L +DG  Q  ++E ++   NP  T + + +TA A   D + A+
Sbjct: 5   QVALLASVQQFLDRQHGLYLDGTQQAAESEQRLTVWNPA-TGQAIASTADANAADVDRAV 63

Query: 83  QGAWKAF--ESWKKWDMDARARILLKAAAILKRRRLEACALMSIEVGK--NYAEADVEVA 138
             AW+AF   SW       R RILL+ A ++++   E   L ++E GK  N + A  EV 
Sbjct: 64  MSAWRAFVSRSWAGRTPADRERILLRFADLVEQHGEELAQLETLEQGKSINISRA-FEVG 122

Query: 139 EAIDFLEYYARSAMKYAG----------FGSSETTWFEGEENGLMSIPLGVGVSISPWNF 188
             ++++ Y A    K +G           G     W + E       P+GV   I PWNF
Sbjct: 123 CTLNWMRYTAGLTTKISGRTLDVSIPFPAGGRYQAWTKKE-------PVGVVAGIVPWNF 175

Query: 189 PCAIFVGMAAAPIVAGNCVVVKPAEDAGLIAGFMVDILREAGLPAGVLQFLPGVGKEVGE 248
           P  I +      + AG  +V+KP+E   L    + ++  EAG+P GV   + G G   G 
Sbjct: 176 PLMIGMWKVMPALAAGCSIVIKPSETTPLTLLRVAELATEAGVPDGVFNVVTGSGAGCGA 235

Query: 249 YLTTHAKTRFITFTGSRAVGLHINEVAAKVQPGQKWIKRVIMELGGKDGLIVDETADIEN 308
            LT+H     ++FTGS A G  I  VAA        + RV +ELGGK+  IV + AD + 
Sbjct: 236 ALTSHPLVAKVSFTGSTATGKQIARVAA------DRLTRVTLELGGKNPAIVLKDADPQW 289

Query: 309 AITAATQGAFGFNGQKCSAMSRLIVVDSVYDEVVNGFVERAKALKMGTGE-ENANVTAVV 367
            I     G+F   GQ C+A SR+ +   ++D +V+GF +  K+L++G G  E++ +  VV
Sbjct: 290 VIEGLMTGSFLNQGQVCAASSRIYIEAPLFDTLVSGFEQAVKSLQVGPGMLESSQINPVV 349

Query: 368 NQMSFNKIKGYLELAPSEGKVLLGGEATGEANGKQGYYIQPTIVGDVDRNSRLAQEEIFG 427
           +Q    K+  YL+ A  +   L+ G A  +A   QGYYI PT+V + D   RL +EE+FG
Sbjct: 350 SQAHCAKVAAYLDEARQQKAELISGHAGPDA---QGYYIAPTLVINPDAGLRLCREEVFG 406

Query: 428 PVVAVLRAKDWQDALDIANSTEYGLTGGVCSNSRERLEQARAEFEVGNLYFNRKITGAIV 487
           PVV ++R  D ++AL +AN +++GLT  V +    +        + G ++ N      I 
Sbjct: 407 PVVNLVRVADGEEALLLANDSDFGLTASVWTRDLTQALSYTDRLQAGTVWVNSHT--LID 464

Query: 488 GVQPFGGYNMSGTDSKAGGPDYLSNFMQLKTVTERW 523
              PFGG   SGT  +  GPD+L ++ + K+V  R+
Sbjct: 465 ANLPFGGMKQSGT-GRDFGPDWLDDWCETKSVCVRY 499


Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 595
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 499
Length adjustment: 35
Effective length of query: 488
Effective length of database: 464
Effective search space:   226432
Effective search space used:   226432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory