Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate BWI76_RS20455 BWI76_RS20455 multifunctional fatty acid oxidation complex subunit alpha
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__Koxy:BWI76_RS20455 Length = 714 Score = 133 bits (335), Expect = 9e-36 Identities = 84/198 (42%), Positives = 122/198 (61%), Gaps = 6/198 (3%) Query: 5 TIETKKEGNLFWITLNRP-DKLNALNAKLLEELDRAVSQAESDPEIR-VIIITGKGKAFC 62 T+E + + N+ IT++ P +K+N L A+ E+ + Q + E+R + I+ K F Sbjct: 8 TLEVRPD-NIAVITIDAPGEKMNTLKAEFASEVRGIIRQIRDNKELRGAVFISAKPDNFI 66 Query: 63 AGADITQFNQLTPA-EAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIR 121 AGADI + A EA +++G++IM +I LS P IA I+G LGGGLELALAC R Sbjct: 67 AGADINMIARCHSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELALACHGR 126 Query: 122 IAAEE--AQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVN 179 + +++ +LGLPE+ LG+ PG GGTQRL R+IG ALEM++TG ++ + A K GLV+ Sbjct: 127 VCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSGALEMILTGKQLRPRQALKAGLVD 186 Query: 180 RVVPLANLEQETRKLAEK 197 VV L Q +LA K Sbjct: 187 EVVAQTILLQTAVELALK 204 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 714 Length adjustment: 32 Effective length of query: 227 Effective length of database: 682 Effective search space: 154814 Effective search space used: 154814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory