GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA in Klebsiella michiganensis M5al

Align propionyl-CoA carboxylase α subunit (EC 6.4.1.3) (characterized)
to candidate BWI76_RS13985 BWI76_RS13985 urea carboxylase

Query= metacyc::MONOMER-13589
         (666 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS13985 BWI76_RS13985 urea
           carboxylase
          Length = 1201

 Score =  382 bits (980), Expect = e-110
 Identities = 233/579 (40%), Positives = 330/579 (56%), Gaps = 40/579 (6%)

Query: 1   MFKKILIANRGEIACRVIKTARKMGIQTVAVYSDADRNALHVSMADEAIHIGPPPANQSY 60
           MF  +LIANRG IACR+++T R M ++ VAVYS+AD ++LH+  ADEA+ +G  PA Q+Y
Sbjct: 1   MFDTLLIANRGAIACRILRTLRAMQVKGVAVYSEADLSSLHIRDADEALSLGDGPAAQTY 60

Query: 61  IVIDKIMEAIKASGAEAVHPGYGFLSERMDFAAALEAAGVVFIGPPSGAIEAMGDKITSK 120
           +  +KI+ A + SGA A+HPGYGFLSE   FA A EAAG+ F+GP    +   G K T++
Sbjct: 61  LATEKIIAAAQQSGARAIHPGYGFLSENAAFAEACEAAGLAFVGPTPRQLRVFGLKHTAR 120

Query: 121 KLAKEAGVSTVPGYMGLIADADEAVKISNEIGYPVMIKASAGGGGKGMRIAWSEAEVKEG 180
            LAK  GV  + G   L+AD+DEA + +  +GYPVM+K++AGGGG GMR+     E+ E 
Sbjct: 121 ALAKAEGVPLLEG-SELLADSDEACRAAEAVGYPVMLKSTAGGGGIGMRVCRDARELTEA 179

Query: 181 FESSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLADKHGNCVYLHERECSIQRRNQKVIE 240
           F + +    N+F D  +F+EK++ + RH+E+Q+  D  G+ + L  R+CS+QRRNQKVIE
Sbjct: 180 FATVQRLGQNNFSDAGVFLEKYIERARHLEVQIFGDGRGDVIALGVRDCSVQRRNQKVIE 239

Query: 241 EAPSPFLDEATRKAMGEQACALAKAVGYASAGTVEFIVDG-QKNFYFLEMNTRLQVEHPV 299
           E P+P L E T +A+   A AL KAV Y SAGTVEF+ D   + FYFLE+NTRLQVEH V
Sbjct: 240 ETPAPNLPEGTAQALCAAAIALGKAVSYRSAGTVEFVYDSTARQFYFLEVNTRLQVEHGV 299

Query: 300 TELITGIDLVEQMIRVAAGEKLPFQ--QSDLKINGWAMESRLYAEDPYRNFLPSIGRLTR 357
           TE + G+DLV  MI +AAG+  P     + L+  G A+++RLYAEDP R F PS G LT 
Sbjct: 300 TEQVWGVDLVRWMIELAAGDLPPLDVLAAGLRPQGHAIQARLYAEDPGRQFQPSPGLLTE 359

Query: 358 -YRPPVESVTPTSVVRNDTGVYEGGEISMYYDPMIAKLCTWAPTREAAIEEMRLALDTFE 416
              PP +     + +R D  V  G E+  ++DPM+AK   W P+R+ AI  +  AL    
Sbjct: 360 AIFPPADG----AALRIDRWVEAGCEVPPFFDPMLAKTIAWRPSRDEAIAGLAQALAETR 415

Query: 417 VEGIGHNLPFVGAVMDHPRFVKGDITT---------AFIAEEYPDGFQGAVLDEPTLRRV 467
           + G+  N  ++  ++    F +G+  T         A   E    G Q +V D P     
Sbjct: 416 LYGVETNRLYLLQILGFAPFTEGEPWTRCLEQLRYRAATVEVLSAGTQTSVQDYPGRLGY 475

Query: 468 AAAAAAMNRVAEIRRTRISGTMNNHERHVGVDWVVALQGESYHVSIAADREGSTVSFSD- 526
            A                SG M++    +G   +   +GE+   ++     G T+ F+  
Sbjct: 476 WAVGVPP-----------SGPMDDRALRLGNRLLGNAEGEA---ALEITLNGPTLKFNTD 521

Query: 527 ------GSSLRVTSDWTPGQPLASLMVDGRPLVMKVGKI 559
                 G+ L VT D    QPL  +        +K+G I
Sbjct: 522 VQAVVCGAPLAVTLDGV-DQPLDRVFTIPAGATLKLGAI 559



 Score = 38.5 bits (88), Expect = 2e-06
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 603  PMPGLVVKINVAEGDEVQEGQALATVEAMKMENILRAERRGTVKKIAAAPGASLR 657
            P+ G + ++  A G  V+ G  L  +E+MKME  L A   G ++++   PG+++R
Sbjct: 1134 PISGNLWQVQTAAGSRVRAGDVLVVLESMKMEIPLLAPCDGVIQQVHVQPGSAVR 1188


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1775
Number of extensions: 85
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 666
Length of database: 1201
Length adjustment: 43
Effective length of query: 623
Effective length of database: 1158
Effective search space:   721434
Effective search space used:   721434
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory