Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate BWI76_RS13410 BWI76_RS13410 polyamine ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__Koxy:BWI76_RS13410 Length = 336 Score = 255 bits (652), Expect = 1e-72 Identities = 144/326 (44%), Positives = 199/326 (61%), Gaps = 27/326 (8%) Query: 18 VQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLD 77 V+ + + + + + + I +GEF ++LGPSG GKTT LRLIAG E + G I + Sbjct: 4 VEFDNVSRLYGDVRAVDGVSIAIRDGEFFSMLGPSGSGKTTCLRLIAGFEQLSGGAIRIF 63 Query: 78 NEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQL 137 N+ + +P R VNTVFQ YALFPHM+V +NVA+GL ++ E R MEAL V L Sbjct: 64 NKPASELPPWQRDVNTVFQDYALFPHMSVLDNVAYGLMVKGIGKKERHARAMEALERVAL 123 Query: 138 ETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKL 197 R+P QLSGGQ+QRVAIARA+VN+PR+LLLDE L ALD KLR+QMQ ELK LQ+ L Sbjct: 124 AFVHARRPSQLSGGQRQRVAIARALVNQPRVLLLDEPLGALDLKLREQMQLELKKLQQAL 183 Query: 198 GITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNAT 257 GITF+FVTHDQ EAL+MSDR+ V +GRIEQ P+++Y PK FVAGF+G N+F+ Sbjct: 184 GITFIFVTHDQGEALSMSDRVAVFNNGRIEQIDAPQDLYLRPKTAFVAGFVGTANVFSGE 243 Query: 258 VIERLDEQRVRANVEGRECNIYVNFAVEPGQKLHVLLRPEDLRVEEINDDNHAEGLIGYV 317 +L C + +++ LRPE +R+ + + G V Sbjct: 244 RAHKL-------------CAMAGSWS----------LRPEHIRLNAAGEIQ----IAGVV 276 Query: 318 RERNYKGMTLESVVELENGKMVMVSE 343 + Y+G ++L +G+ ++VS+ Sbjct: 277 QAVQYQGAATRVELKLADGEKLLVSQ 302 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 336 Length adjustment: 29 Effective length of query: 349 Effective length of database: 307 Effective search space: 107143 Effective search space used: 107143 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory