Align Putrescine importer PuuP (characterized)
to candidate BWI76_RS03640 BWI76_RS03640 amino acid permease-associated protein
Query= SwissProt::P76037 (461 letters) >FitnessBrowser__Koxy:BWI76_RS03640 Length = 447 Score = 245 bits (625), Expect = 2e-69 Identities = 142/439 (32%), Positives = 251/439 (57%), Gaps = 22/439 (5%) Query: 15 KTRLRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYLLALAGVLFTAISYG 74 K L ++L +++ G+ ++ P+ F FG V + G V +YL+ + + FTA+SY Sbjct: 9 KQELHRALTFRDLLVYGMIFMVPIAPFGVFGYVWDGAQGMVALAYLIGMVAMFFTAMSYW 68 Query: 75 KLVRQFPEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLLAKIYLSALFPEVPP 134 + R FP +GS Y YAQ+ I+P VGF GW LLDY+ +P + +++ L+ + P VP Sbjct: 69 SMSRAFPVSGSVYAYAQRGIHPIVGFFAGWLILLDYILVPSLLYIVSAAALAPMLPGVPG 128 Query: 135 WVWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQGLHKGEGVGTVWSL 194 W+W+V F+AI + NL+ + A N ++ +I ++ VF+ L + L+ G G G + +L Sbjct: 129 WLWIVGFIAINSLINLRGITFTARANNTILIAEIVVLSVFVVLGLIALYSGAGAGHL-TL 187 Query: 195 QPFISENAHLIPIITGA-TIVCFSFLGFDAVTTLSEETPDAARVIPKAIFLTAVYGGVIF 253 P + + +P++ GA +I SFLGFD ++TLSEET D + KA G ++ Sbjct: 188 DPLYNADKFSLPLVMGAVSIAVLSFLGFDGISTLSEETKDGVDTVGKASL-----GALML 242 Query: 254 IAASFFMQLFF-PDISR---FKDPDAALPEIALYVGGKLFQSIFLCTTFVN-TLASGLAS 308 + + F +Q + D+++ F D A + A GG + + + +T ++ +A+ L + Sbjct: 243 VGSLFILQTWIAADLAQGMTFSSLDTAFYDTANLAGGGWLKYVTMWSTVISWGIANALVA 302 Query: 309 HASVSRLLYVMGRDNVFPERVFGYVHPKWRTPALNVIMVGIVAL-SALFF--DLVTATAL 365 A+VSR+L+ M RD P+ + VHP+ +TP ++ + V +++L S L+F D+ + L Sbjct: 303 QAAVSRILFAMARDKQLPQ-LLAKVHPRLKTPYVSTLFVALISLASGLWFYGDIDNLSRL 361 Query: 366 INFGALVAFTFVNLSVFNHFWRRKGMNKSWKDHFHYLLMPLVGALTVGVLWVNLESTSLT 425 +NFGAL+ F ++++V N++ R+ KS ++ +LL P+VG +G + +++ + Sbjct: 362 VNFGALMGFLVLHIAVINYYIIRQ---KS-RNLVVHLLFPVVGLCIIGFVIYEMDAQAKV 417 Query: 426 LGLVWASLGGAYLWYLIRR 444 LGL W ++G Y YL+ R Sbjct: 418 LGLSWLAVGVVY--YLLMR 434 Lambda K H 0.328 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 613 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 447 Length adjustment: 33 Effective length of query: 428 Effective length of database: 414 Effective search space: 177192 Effective search space used: 177192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory