Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate BWI76_RS16755 BWI76_RS16755 acetoin reductase
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >FitnessBrowser__Koxy:BWI76_RS16755 Length = 256 Score = 140 bits (353), Expect = 3e-38 Identities = 91/263 (34%), Positives = 136/263 (51%), Gaps = 19/263 (7%) Query: 6 KVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVA-EIEALGRRV 64 KV +VTG +GIG+AIA+ +G VAI + D A A+ VA EI G R Sbjct: 3 KVALVTGAGQGIGKAIALRLVKDGFAVAIADYND---------ATAQAVADEINRSGGRA 53 Query: 65 IAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNLNG 124 +A++ +V+ R+ V + G DV+ +NAG+ P ++ +V++ +N+ G Sbjct: 54 LAVKVDVSQRDQVFAAVEQARKGLGGFDVIVNNAGVAPSTPIEEIREDVIDKVYNINVKG 113 Query: 125 AFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALGPY 184 + QAA + K +G GG I+ S + VG Y+ +K V L Q+ A L Sbjct: 114 VIWGIQAAVEAFKQEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAHL 173 Query: 185 GIRCNSVMPGTIATDLNAQ---DLADEAKKAY------FEKRIPLGRLGRPEDVADCVTF 235 GI N PG + T + A+ +++ A K F KRI LGRL PEDVA CV++ Sbjct: 174 GITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTQEFAKRITLGRLSEPEDVAACVSY 233 Query: 236 LASDRARYVTGAALLVDGGLFVN 258 LA + Y+TG +LL+DGG+ N Sbjct: 234 LAGPDSNYMTGQSLLIDGGMVFN 256 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory