Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate BWI76_RS10695 BWI76_RS10695 aldehyde dehydrogenase PuuC
Query= metacyc::MONOMER-16244 (495 letters) >FitnessBrowser__Koxy:BWI76_RS10695 Length = 495 Score = 375 bits (964), Expect = e-108 Identities = 202/476 (42%), Positives = 281/476 (59%), Gaps = 5/476 (1%) Query: 21 TGLFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAF-HSSWSTSD 79 T LFIN E+ + F T+ P+ ++ + +V D+D AV+AA F WS + Sbjct: 20 TRLFINGEYSAAADNSVFATIDPAAQQTLAEVARGKKADVDRAVQAARGVFDRGDWSQAS 79 Query: 80 PQVRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCS-KGDVALTAAYFRSCAGWTDKIK 138 P R VL K ADL+D H + LA +E LD GK + S + D+ A R A DK+ Sbjct: 80 PAQRKAVLTKFADLMDAHREELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVY 139 Query: 139 GSVIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLS 198 G V TG REPIGV ++PWNFPLL+A WKLGP L +G + VLK +E +PL+ Sbjct: 140 GEVAPTGGNELAMIVREPIGVIAAVVPWNFPLLLACWKLGPALASGNSVVLKPSEKSPLT 199 Query: 199 ALYLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAES 258 AL LA L K+AG P GV NVVSGFG AG ++ HP ++ + FTGST T + ++K A +S Sbjct: 200 ALRLAGLAKQAGLPDGVFNVVSGFGHEAGQALALHPDVEVITFTGSTRTAKQLLKDAGDS 259 Query: 259 NLKKVTLELGGKSPNIVFDDA-DVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIV 317 N+K+V LE GGKS NIVF D D++ + GIFYN G+VC AG+R+ ++E I D+ + Sbjct: 260 NMKRVWLEAGGKSANIVFADCPDLQKAVNATAGGIFYNQGQVCIAGTRLLLEESIADRFL 319 Query: 318 SEFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNKGY 377 K A+ + G+P +T MG D + +I G+ ++ G R Sbjct: 320 DLLKEQAKGWQPGNPLDPNTTMGMLIDNTHADSVHSFIRAGEAHSTLLLDG--RKNPWPA 377 Query: 378 FIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTA 437 + PTIF DV + ++EIFGPV+ +T+FK E+ +ALANDS YGL A V T +LS A Sbjct: 378 AVGPTIFVDVDPASPLSQEEIFGPVLVVTRFKNEEQALALANDSRYGLGAAVWTRDLSRA 437 Query: 438 ISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRIGL 493 VS ++ +G+++VN YND VPFGGY QSG GR+ AL+ +T++K + I L Sbjct: 438 HRVSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWIAL 493 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 576 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 495 Length adjustment: 34 Effective length of query: 461 Effective length of database: 461 Effective search space: 212521 Effective search space used: 212521 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory