Align Lactaldehyde reductase (characterized, see rationale)
to candidate BWI76_RS03580 BWI76_RS03580 iron-containing alcohol dehydrogenase
Query= uniprot:Q8A199 (384 letters) >FitnessBrowser__Koxy:BWI76_RS03580 Length = 380 Score = 216 bits (549), Expect = 1e-60 Identities = 133/395 (33%), Positives = 209/395 (52%), Gaps = 30/395 (7%) Query: 1 MNRIILNETSYFGAGCRSVIAVEAARRGFKKAFFVTDKDLIKFGVAAEIIKVFDDNHIPY 60 M+ +L FG +++ AR VTD+ ++KFG+A + ++ + I + Sbjct: 1 MSEFLLKPRIRFGQDALAILNELPARN----VLLVTDQAMVKFGLADRVTQILNARGIAF 56 Query: 61 ELYSDVKANPTIANVQNGVAAYKASGADFIVALGGGSSIDTAKGIGIVVNNPDFADVKSL 120 +++ DV A+P IA V G+ +S D ++ALGGGS ID AK + + +L Sbjct: 57 QVWDDVVADPDIATVVRGMKRMDSSYPDLVIALGGGSVIDAAKAV-----------IFAL 105 Query: 121 EGVADTKHKAVPTF-ALPTTAGTAAEVTINYVIIDEDARKKMVCVDPNDIPAVAIVDPEL 179 H+ P F A+PTT+GT +EVT V+ + +K+V VDP+ +P +AI+DP L Sbjct: 106 AQTRPDAHREPPCFVAIPTTSGTGSEVTAFSVV--KAHAEKLVLVDPSLLPDIAILDPAL 163 Query: 180 MYSMPKGLTAATGMDALTHAIESYITPGAWAMSDMFELKAIEMIAQNLKAAVDNGKDTVA 239 + S+P +TA TGMD L HA+E+Y++ A SD K ++ + L NG D +A Sbjct: 164 VASVPPAITADTGMDVLCHALEAYVSRAASDFSDALAEKVVQQVFSYLPTCWRNGGDLLA 223 Query: 240 REAMSQAQYIAGMGFSNVGLGIVHSMAHPLGAFYDTPHGVANALLLPYVMEYNAE----- 294 RE M A +AGM F+N LGI HS+AH LG + PHG ANALL+ V+ +NA+ Sbjct: 224 REKMHNASCMAGMAFTNASLGITHSLAHALGGVFRVPHGRANALLMAEVVAWNADYQGQC 283 Query: 295 -SPAAPKYIHIAKAMGVNTDGMTETEGVKAAIEAVKALSLSIGIPQKLHEINVK----EE 349 + AA KY +A + + +GV + + A++AL + +P + + + E+ Sbjct: 284 ATDAARKYARLAHLL--DLPAANTRQGVASLLVAIQALKDEMSMPTGIRDTGIDAADFEQ 341 Query: 350 DIPALAVAAFNDVCTGGNPRPTSVAEIEVLYRKAF 384 + + A D CT NPR + LYR+A+ Sbjct: 342 RLTEMVGQALRDSCTPTNPRAPDAHALTELYRRAW 376 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 380 Length adjustment: 30 Effective length of query: 354 Effective length of database: 350 Effective search space: 123900 Effective search space used: 123900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory