Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate BWI76_RS07650 BWI76_RS07650 ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Koxy:BWI76_RS07650 Length = 351 Score = 251 bits (641), Expect = 2e-71 Identities = 135/319 (42%), Positives = 191/319 (59%), Gaps = 8/319 (2%) Query: 13 YQRISRYQSIFILLGLIVLFSFLSNRFLTLENFWIILRQTAVNLCIAVGMTFVILTGGID 72 Y + + ++ LL +I FS + FLT N I+ + A+ +A+GMT VILTGGID Sbjct: 8 YMYLLKARTFIALLLVIAFFSVMVPNFLTTSNLLIMTQHVAITGLLAIGMTLVILTGGID 67 Query: 73 LSVGSILGFSGAVTAKLLKYGLILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGFIITRF 132 LSVG++ G G V LL GL L G V+ FN + L G +G NG +ITRF Sbjct: 68 LSVGAVAGICGMVAGALLTNGLPLWN-GSVIFFNVPEVILCVALFGVLVGFVNGAVITRF 126 Query: 133 NIPPFVATLGTMTAVRGFIMLLTKGHPITRLGD-------SFDFIGSGWFLGIPMPVWIA 185 + PF+ TLG M RG +L G L F +GSG +GI +P+W+ Sbjct: 127 GVAPFICTLGMMYVARGSALLFNDGSTYPNLNGMEALGNTGFSTLGSGTLMGIYLPIWLM 186 Query: 186 AIATGVGIFILRKTQFGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGLIVT 245 +G ++ KT GRY+YA+GGNE AA L+GV K++VYA SG+ SA GLIV Sbjct: 187 IGFLLLGYWLTTKTPLGRYIYAIGGNESAARLAGVPIVKAKIFVYAFSGLCSAFVGLIVA 246 Query: 246 ARLDSAQPNAGLMYELDAIAATVIGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVGVSP 305 ++L +A P G M+E+DAI ATV+GG +L+GG+G + G+++GA +I L DG+V++GVS Sbjct: 247 SQLQTAHPMTGNMFEMDAIGATVLGGTALAGGRGRVTGSIIGAFVIVFLADGMVMMGVSD 306 Query: 306 FWQQVAKGFIIIAAVIAEK 324 FWQ V KG +I+ AV+ ++ Sbjct: 307 FWQMVIKGVVIVTAVVVDQ 325 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 351 Length adjustment: 28 Effective length of query: 303 Effective length of database: 323 Effective search space: 97869 Effective search space used: 97869 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory