Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate BWI76_RS14605 BWI76_RS14605 ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Koxy:BWI76_RS14605 Length = 336 Score = 234 bits (596), Expect = 3e-66 Identities = 133/292 (45%), Positives = 183/292 (62%), Gaps = 11/292 (3%) Query: 30 VLFSFLSNRFLTLENFWIILRQTAVNLCIAVGMTFVILTGGIDLSVGSILGFSGAVTAKL 89 V+FS +++ FLT N+ I+RQ+A L +A MT VI TGGIDLSVGS L GA++A Sbjct: 39 VVFSLITSNFLTGTNWLNIIRQSAPLLIVATAMTLVITTGGIDLSVGSTLALVGALSA-- 96 Query: 90 LKYGLILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGFIITRFNIPPFVATLGTMTAVRG 149 + L+ +G+ LG G+L G +G NGF I IP F+ TL T+ VRG Sbjct: 97 ----IALNNWGLPWPVVLLG----GLLLGGIVGAINGFFIAYEGIPAFIVTLATLAVVRG 148 Query: 150 FIMLLTKGHPITRLGDS-FDFIGSGWFLGIPMPVWIAAIATGVGIFILRKTQFGRYVYAV 208 +L+T+G+ I DS F FIG W +GIPMP I + +G +L +FGRYV A+ Sbjct: 149 IALLVTQGYSIPVPADSLFTFIGRAWVVGIPMPALIGIMILLIGHIVLNHMRFGRYVTAI 208 Query: 209 GGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGLIVTARLDSAQPNAGLMYELDAIAATV 268 G N + A SG+N+K + VY ISG+ +A+AG+I+TARL S N G +EL IAA V Sbjct: 209 GANAEGARRSGINTKAVTMKVYIISGMAAALAGMIITARLGSGSSNQGEGFELQVIAAVV 268 Query: 269 IGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVGVSPFWQQVAKGFIIIAAV 320 +G SL GG GT+IGT++GAL I V+ +GL+L +SPF+ Q+A G II+ A+ Sbjct: 269 LGSTSLFGGFGTIIGTLLGALSIAVIQNGLILSHISPFYTQIATGTIILLAI 320 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 336 Length adjustment: 28 Effective length of query: 303 Effective length of database: 308 Effective search space: 93324 Effective search space used: 93324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory